Merops nubicus (carmine bee-eater): 103781052 Help Entry 103781052         CDS       T08417                                  Symbol NPS Name (RefSeq) neuropeptide S   KO K25691   neuropeptide S Organism mnb  Merops nubicus (carmine bee-eater) Pathway mnb04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:mnb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     103781052 (NPS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mnb04052]     103781052 (NPS) Cytokines and neuropeptides [BR:mnb04052]  Neuropeptides   GPCR binding    103781052 (NPS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Neuropeptide_S Motif Other DBs NCBI-GeneID:  103781052 NCBI-ProteinID:  XP_008947007 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search LCRLNFVFILWISMIFVCSSYPVAPSMSSNPFYLNCQLYGRADDCLVLLKSCLAKVGRAE ELPFLKPLLGLPLHKRSFRNGVGSGIKKTSFRRAKS NT seq 292 nt NT seq  +upstreamnt  +downstreamnt tctctgcaggttgaacttcgtgttcattctgtggatctcaatgatattcgtgtgctcgag ttacccagttgccccttccatgagcagcaatcctttctatttgaactgccagctgtatgg aagggctgatgactgcctcgtgctgctgaagagctgcttggccaaggtgggcagggctga agagctgccttttctaaagcctctcctggggctgcctctccacaaacgttccttccgcaa cggcgttggctcaggaattaaaaaaacttccttccgaagagcaaagtcctaa

DBGET integrated database retrieval system