Merops nubicus (carmine bee-eater): 103781125 Help Entry 103781125         CDS       T08417                                  Symbol ARF4 Name (RefSeq) ADP-ribosylation factor 4   KO K07939   ADP-ribosylation factor 4 Organism mnb  Merops nubicus (carmine bee-eater) Pathway mnb04144   Endocytosis Brite KEGG Orthology (KO) [BR:mnb00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103781125 (ARF4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mnb04131]     103781125 (ARF4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mnb04147]     103781125 (ARF4)    04031 GTP-binding proteins [BR:mnb04031]     103781125 (ARF4) Membrane trafficking [BR:mnb04131]  Endosome - Golgi transport   Arf GTPases and associated proteins    Arf GTPases     103781125 (ARF4) Exosome [BR:mnb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103781125 (ARF4)   Exosomal proteins of other body fluids (saliva and urine)    103781125 (ARF4)   Exosomal proteins of colorectal cancer cells    103781125 (ARF4) GTP-binding proteins [BR:mnb04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     103781125 (ARF4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc Ras SRPRB G-alpha Gtr1_RagA MMR_HSR1 FLAD1_M GTP_EFTU CRISPR_Cas2 RXYLT1_N Csa3_N TPM_phosphatase Motif Other DBs NCBI-GeneID:  103781125 NCBI-ProteinID:  XP_008947075 LinkDB All DBs Position Unknown AA seq 159 aa AA seqDB search LVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHY FQNTQGLIFVVDSNDRERIEEAAEELQKMLDEDELQDAVLLLFANKQDLPNAMAISEMTD KLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR NT seq 480 nt NT seq  +upstreamnt  +downstreamnt ctagttggtttggatgctgctggtaagacaactattctttataaactgaaactaggagaa attgtcaccacaattcccactattggttttaatgtggaaacagtagaatataaaaacatc tgtttcacagtttgggatgttggtggtcaagataaaattagacctctttggaggcattat ttccaaaacacacagggcctcattttcgtcgtagacagcaatgacagagagagaattgag gaagcagcagaggaactgcagaagatgcttgatgaggatgagctgcaagatgcagtcctg cttctatttgcaaacaaacaagatctgccaaatgccatggcaatcagtgaaatgacagat aaactaggtcttcagtctctgcgtaacagaacttggtatgtccaggctacctgtgctacg caaggaactggtctgtatgagggacttgactggctgtcaaatgaactctcaaaacgctaa

DBGET integrated database retrieval system