KEGG   Merops nubicus (carmine bee-eater): 103781530
Entry
103781530         CDS       T08417                                 
Name
(RefSeq) molybdopterin synthase catalytic subunit
  KO
K03635  molybdopterin synthase catalytic subunit [EC:2.8.1.12]
Organism
mnb  Merops nubicus (carmine bee-eater)
Pathway
mnb00790  Folate biosynthesis
mnb01100  Metabolic pathways
mnb01240  Biosynthesis of cofactors
mnb04122  Sulfur relay system
Module
mnb_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:mnb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    103781530
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    103781530
Enzymes [BR:mnb01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     103781530
SSDB
Motif
Pfam: MoaE
Other DBs
NCBI-GeneID: 103781530
NCBI-ProteinID: XP_008947497
LinkDB
Position
Unknown
AA seq 155 aa
MDESEDVPKDFIKLKSEKLSVDEVSEMVISPYCGAVSLFIGTTRNNFEGKKVIRLEYEAY
TSMAETEIKKICRDVRQKWPSVKHIAVHHRLGVVPVTEASVVIAVSSPHRAESLEAVMYC
INTLKASVPIWKKEIYEDEYSWKENKECFWANSEK
NT seq 468 nt   +upstreamnt  +downstreamnt
atggatgaaagcgaagatgtgccaaaagattttatcaagctaaagtctgaaaagctctct
gtagatgaagtgtcagagatggtcatttcaccatactgtggggcagtgtctttgttcatt
ggtactacaagaaacaattttgaagggaagaaagtgattcgcttagaatatgaagcatat
acttcaatggcagagactgaaatcaagaaaatctgcagagatgttagacagaaatggcca
tcagtcaaacatattgcagtgcaccacagacttggtgtggttccagtaactgaagcaagt
gtggttattgcagtctcctctccacacagagcagaatcccttgaagctgtaatgtactgc
atcaataccttaaaagcatctgtcccaatatggaagaaggaaatttatgaggatgaatat
tcttggaaagaaaacaaggaatgcttttgggcaaattcagaaaagtag

DBGET integrated database retrieval system