Merops nubicus (carmine bee-eater): 103781606 Help Entry 103781606         CDS       T08417                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism mnb  Merops nubicus (carmine bee-eater) Pathway mnb04010   MAPK signaling pathway mnb04012   ErbB signaling pathway mnb04068   FoxO signaling pathway mnb04137   Mitophagy - animal mnb04140   Autophagy - animal mnb04150   mTOR signaling pathway mnb04210   Apoptosis mnb04218   Cellular senescence mnb04370   VEGF signaling pathway mnb04371   Apelin signaling pathway mnb04519   Cadherin signaling mnb04540   Gap junction mnb04625   C-type lectin receptor signaling pathway mnb04810   Regulation of actin cytoskeleton mnb04910   Insulin signaling pathway mnb04912   GnRH signaling pathway mnb04916   Melanogenesis Brite KEGG Orthology (KO) [BR:mnb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103781606 (NRAS)    04012 ErbB signaling pathway     103781606 (NRAS)    04370 VEGF signaling pathway     103781606 (NRAS)    04371 Apelin signaling pathway     103781606 (NRAS)    04068 FoxO signaling pathway     103781606 (NRAS)    04150 mTOR signaling pathway     103781606 (NRAS)   09133 Signaling molecules and interaction    04519 Cadherin signaling     103781606 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103781606 (NRAS)    04137 Mitophagy - animal     103781606 (NRAS)   09143 Cell growth and death    04210 Apoptosis     103781606 (NRAS)    04218 Cellular senescence     103781606 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     103781606 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103781606 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103781606 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     103781606 (NRAS)    04912 GnRH signaling pathway     103781606 (NRAS)    04916 Melanogenesis     103781606 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mnb04131]     103781606 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mnb04147]     103781606 (NRAS)    04031 GTP-binding proteins [BR:mnb04031]     103781606 (NRAS) Membrane trafficking [BR:mnb04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     103781606 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     103781606 (NRAS) Exosome [BR:mnb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103781606 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    103781606 (NRAS)   Exosomal proteins of breast cancer cells    103781606 (NRAS)   Exosomal proteins of colorectal cancer cells    103781606 (NRAS) GTP-binding proteins [BR:mnb04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103781606 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf FeoB_N RsgA_GTPase MMR_HSR1 IL23 Motif Other DBs NCBI-GeneID:  103781606 NCBI-ProteinID:  XP_008947577 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search QDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLY REQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAF YTLVREIRQYRMKKLNSNEDGNQGCMGLSCVVM NT seq 462 nt NT seq  +upstreamnt  +downstreamnt caggattcatatagaaagcaggttgtcatagatggagagacgtgcttgttagacattctg gacactgcaggacaagaggagtacagtgccatgcgtgatcagtacatgagaacaggggaa ggattcctctgtgtttttgccattaacaacagtaaatcgtttgctgatattaacctttac agagaacagatcaagagagtgaaagattcagatgatgtgccaatggtgctagttgggaat aagtgtgatttgcccacaagaacagtagacacaaagcaggctcaagaattagcaaaaagc tatggaatccccttcatagagacatctgctaaaacaagacagggtgtggaagatgctttt tacacgctggtgagagagatccggcagtaccggatgaaaaagctcaacagcaatgaagat ggaaatcaaggctgtatgggattgtcttgcgttgtgatgtga

DBGET integrated database retrieval system