Microbacterium neungamense: JSY13_05990 Help Entry JSY13_05990       CDS       T09212                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mnf  Microbacterium neungamense Pathway mnf01100   Metabolic pathways mnf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mnf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JSY13_05990    00074 Mycolic acid biosynthesis     JSY13_05990   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JSY13_05990 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  UWF78531 LinkDB All DBs Position complement(1244262..1244510) Genome browser AA seq 82 aa AA seqDB search MALTHDEVLAGLAELITDETGIDASDVAMEKSFTDDLDIDSISMMTIVVNAEEKFGVTIP DDEVKNLKTVADAVNFIVAGQE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggctctcacccacgacgaggtcctcgccggccttgccgagctgatcaccgacgagacc ggcatcgacgcgtccgatgtcgcgatggagaagtcgttcaccgacgacctcgacatcgac tcgatctcgatgatgacgatcgtcgtcaatgccgaggagaagttcggcgtcaccatcccg gacgacgaggtcaagaacctgaagaccgtcgccgacgccgtcaacttcatcgtcgccggc caggagtaa

DBGET integrated database retrieval system