Monoraphidium neglectum: MNEG_0417 Help Entry MNEG_0417         CDS       T05028                                  Name (RefSeq) hypothetical protein   KO K16466   centrin-3 Organism mng  Monoraphidium neglectum Brite KEGG Orthology (KO) [BR:mng00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mng03019]     MNEG_0417    03036 Chromosome and associated proteins [BR:mng03036]     MNEG_0417 Messenger RNA biogenesis [BR:mng03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      MNEG_0417     Nuclear pore complex      MNEG_0417 Chromosome and associated proteins [BR:mng03036]  Eukaryotic type   Centrosome formation proteins    Centriole proteins     MNEG_0417 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 HTH_Tnp_Tc3_2 Motif Other DBs NCBI-GeneID:  25726535 NCBI-ProteinID:  XP_013906547 UniProt:  A0A0D2KBE8 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search MEGEVAYAFDRLSEGQDGEVTPRQLKIALRAMGFPVKKADVRSLLRDAGLDAALPLCFDS FREVDITPDELHDMVVEFDADGDGLISEGEFAAILAAADE NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggagggcgaggtcgcgtatgcgtttgaccgcctgtcagagggccaggacggcgaggtg acaccacggcagctcaagatcgcgctgcgtgccatgggctttccagtgaaaaaagccgac gtgcggtcactgctgcgcgatgccggccttgatgcggccttgccgctctgctttgactcg ttccgagaggtggacatcacccctgacgagctgcacgacatggtagttgagtttgatgct gacggggacggcctcatatcagagggggagtttgcagctatcctggcagcggctgacgag tga

DBGET integrated database retrieval system