Monoraphidium neglectum: MNEG_1305 Help Entry MNEG_1305         CDS       T05028                                  Name (RefSeq) hypothetical protein   KO K12624   U6 snRNA-associated Sm-like protein LSm5 Organism mng  Monoraphidium neglectum Pathway mng03018   RNA degradation mng03040   Spliceosome Brite KEGG Orthology (KO) [BR:mng00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     MNEG_1305   09123 Folding, sorting and degradation    03018 RNA degradation     MNEG_1305  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mng03019]     MNEG_1305    03041 Spliceosome [BR:mng03041]     MNEG_1305 Messenger RNA biogenesis [BR:mng03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      MNEG_1305   mRNA degradation factors    5'-3' decay     Lsm complex      MNEG_1305 Spliceosome [BR:mng03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     MNEG_1305 SSDB OrthologParalogGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  25730473 NCBI-ProteinID:  XP_013905672 UniProt:  A0A0D2K926 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MIAQKRGPPAANPSHLLPSELIDRCIGSRIWVIMKGDKEIVGTLRGFDVYVNMVLEDVAE IEITPEGRIINRLDTILLNGNNIAVLVPGGQPDDLA NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgatcgcccaaaaacgcggcccccctgcagccaacccgtctcacctgttgcccagcgag ctcatcgaccgctgcatcgggtctcgcatctgggtgatcatgaagggcgacaaggagatt gtgggcaccctgcgcggctttgacgtgtacgtgaacatggtgctggaggatgtcgcggag atcgagatcacgccagagggccgcatcatcaaccgcctcgacaccatcctgctcaacggc aacaacatcgccgtgctcgtgccgggcgggcagccggacgacctcgcttga

DBGET integrated database retrieval system