Monoraphidium neglectum: MNEG_4070 Help Entry MNEG_4070         CDS       T05028                                  Name (RefSeq) Dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism mng  Monoraphidium neglectum Pathway mng04814   Motor proteins Brite KEGG Orthology (KO) [BR:mng00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     MNEG_4070  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mng03037]     MNEG_4070    04812 Cytoskeleton proteins [BR:mng04812]     MNEG_4070 Cilium and associated proteins [BR:mng03037]  Motile cilia and associated proteins   Dynein arm    MNEG_4070 Cytoskeleton proteins [BR:mng04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      MNEG_4070 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Synaptobrevin Motif Other DBs NCBI-GeneID:  25736948 NCBI-ProteinID:  XP_013902906 UniProt:  A0A0D2MTS7 LinkDB All DBs Position Unknown AA seq 114 aa AA seqDB search MDDAASVPDETGFVADEVTAIVKEAVDGVLAAEAYNEQMVGRWTSNCLEGCVKRLVALGK PYKYIVTCTIMQKTGAGLHTAASAYYDTATDGSRTIRWENKSMYAITTVFALAA NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atggacgatgcagcatcagtgccagatgagaccgggttcgtggcagacgaggtgaccgca attgtcaaggaggcggtggacggcgtcctggcggcggaggcatacaacgagcagatggtg gggcggtggacgagcaactgcctggagggctgcgtgaagcggctggtggcgctggggaag ccctacaagtacatcgtgacatgcaccatcatgcagaagacgggtgccggcctgcacaca gctgcatcggcctactacgacaccgccacagacggcagccgcacgattcggtgggaaaac aagtccatgtatgccatcacaacagtttttgcgctggctgcatga

DBGET integrated database retrieval system