Monoraphidium neglectum: MNEG_4157 Help Entry MNEG_4157         CDS       T05028                                  Name (RefSeq) Ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism mng  Monoraphidium neglectum Brite KEGG Orthology (KO) [BR:mng00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:mng03041]     MNEG_4157   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mng04052]     MNEG_4157 Spliceosome [BR:mng03041]  Complex B   Other components    Complex B specific factors     MNEG_4157 Cytokines and neuropeptides [BR:mng04052]  Neuropeptides   Unclassified    MNEG_4157 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD OTU1_UBXL Ubiquitin_4 Motif Other DBs NCBI-GeneID:  25737035 NCBI-ProteinID:  XP_013902819 UniProt:  A0A0D2MLR3 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVILNDRLGKKVRIKCNEDDTIGDLKKLVAAQTGTRPEKIRIQKWYTVYKDHITLSDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaggtgatcctcaacgatcgcctgggcaagaaggtgcgcatcaagtgcaacgag gatgacaccataggggacctcaaaaagctggtggcggcgcagacgggcacgcgccccgag aaaatccgcatccagaaatggtacaccgtctacaaggaccacatcaccctctcagactat gagatccacgacggcatgggcctggagctctactacaactga

DBGET integrated database retrieval system