Monoraphidium neglectum: MNEG_5004 Help Entry MNEG_5004         CDS       T05028                                  Name (RefSeq) hypothetical protein   KO K12456   anaphase-promoting complex subunit 13 Organism mng  Monoraphidium neglectum Pathway mng04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:mng00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MNEG_5004  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mng04121]     MNEG_5004    03036 Chromosome and associated proteins [BR:mng03036]     MNEG_5004 Ubiquitin system [BR:mng04121]  Ubiquitin ligases (E3)   Multi subunit type E3    APC/C     Other subunits      MNEG_5004 Chromosome and associated proteins [BR:mng03036]  Eukaryotic type   Sister chromatid separation proteins    APC/C complex     MNEG_5004 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Apc13p Motif Other DBs NCBI-GeneID:  25737881 NCBI-ProteinID:  XP_013901977 UniProt:  A0A0D2JW48 LinkDB All DBs Position Unknown AA seq 82 aa AA seqDB search MSRTVASSQLMDPFLIDVVDEEWMRDTLPDDDVPLPPGVAPPPDDSDDLLLRGGGGSDAP GNGRGSRPGREGWGDLGVDGLH NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgagccgcactgtggcgtcgtcccagctgatggaccccttcctgatcgacgtcgtggac gaggagtggatgcgggacacgctgcctgacgacgacgtaccgctgcctcccggcgtggcg cccccgcccgatgactcagacgacctgctgctgcggggcggagggggcagcgacgcgccg ggcaacggccgcggcagccggccgggccgggagggctggggcgatctgggggtggatggc ctccactga

DBGET integrated database retrieval system