Monoraphidium neglectum: MNEG_8296 Help Entry MNEG_8296         CDS       T05028                                  Name (RefSeq) dynein light chain LC8-type   KO K10418   dynein light chain LC8-type Organism mng  Monoraphidium neglectum Pathway mng04145   Phagocytosis mng04517   IgSF CAM signaling mng04814   Motor proteins Brite KEGG Orthology (KO) [BR:mng00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     MNEG_8296  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     MNEG_8296   09142 Cell motility    04814 Motor proteins     MNEG_8296  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mng03037]     MNEG_8296    04812 Cytoskeleton proteins [BR:mng04812]     MNEG_8296 Cilium and associated proteins [BR:mng03037]  Motile cilia and associated proteins   Dynein arm    MNEG_8296 Cytoskeleton proteins [BR:mng04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      MNEG_8296 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Nop SpoIIIAH Motif Other DBs NCBI-GeneID:  25741172 NCBI-ProteinID:  XP_013898684 UniProt:  A0A0D2M8U7 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MASGVELRKAVIKNADMSEEMQADAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHC IVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggcgtccggcgtggagctgcgcaaggctgtgatcaagaacgctgacatgtctgaggaa atgcaggccgatgcagtggattgcgccacccaggcgctcgagaagtacaacatcgagaag gacatcgctgcatatatcaagaaggagttcgacaagaagtacaatcccacctggcactgc atcgtcggccgcaactttggatcgtacgtaacccacgagaccaagcattttatttatttc tatctggggcaagtggcgatcctgctgttcaagtccggctga

DBGET integrated database retrieval system