KEGG   Monoraphidium neglectum: MNEG_8644
Entry
MNEG_8644         CDS       T05028                                 
Name
(RefSeq) flagellar associated protein
  KO
K24225  cilia- and flagella-associated protein 53
Organism
mng  Monoraphidium neglectum
Brite
KEGG Orthology (KO) [BR:mng00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mng03037]
    MNEG_8644
Cilium and associated proteins [BR:mng03037]
 Motile cilia and associated proteins
  Other motile cilia associated proteins
   MNEG_8644
SSDB
Motif
Pfam: TPH
Other DBs
NCBI-GeneID: 25741519
NCBI-ProteinID: XP_013898338
UniProt: A0A0D2KVA4
LinkDB
Position
Unknown
AA seq 484 aa
MTAKKPPPDARITKIREYEDRMQQMQQAAKEESKLGSGAAWQHKTDARIQRNAEQACFEA
LRAARAGEIELRRERLAQKLAEEEQALKEELAAAQQTPAQRRAAMAERAREMAVRREGER
QALAQELLDAAFRDNCDPLRERYSRQITQRTQHEWGKQLEERRSTMALAAKERRLEDAMF
AEQTIRAEQRHQDDLRRQKESTQAVKASLDGQVHHVRERQAAEAEADAREVAAMRAHWER
LEADAAAADAAERERLRRLAAEVKEFNRLKLAEMSAAERRERELNLRILQDALAREAAEE
AADQAAREAKRQEVLHYRHQLALSMQREAEAAGERDLLIERANREKQAAQDAEWAAREEA
RRRLMAEVDAIRRVQIAYKQEQKRLGKESKRQELDQAIAAERREEAEAAAAAAEARRKAL
QQSLDVKTQVMARAHLRAAAAEDKVHAAELAHASEERYLQRVAAAEQRIAPPTFFGRKKV
EWMH
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgaccgcgaagaagccaccgcccgacgcacgcatcaccaagatccgcgagtatgaggat
cggatgcagcagatgcagcaggcggccaaggaggaaagcaagctcggctcaggtgcagcg
tggcagcacaagacggacgcgcgcatccagcgcaacgccgagcaggcatgcttcgaggcg
ctgcgcgcggcccgcgcgggggagatcgagctgaggcgcgagcggctagctcagaagctg
gcggaagaggagcaggcgctcaaggaggagctggcggccgcgcagcagacgcccgcgcag
cggcgggcggcgatggcggagcgcgcgcgggagatggcggtgcggcgcgaaggggagcgg
caggccctggcccaggagctgcttgatgcggccttccgggacaactgcgaccccctgagg
gagcgctacagccgccagatcacgcagcgcacgcagcacgagtggggcaagcagctggag
gagcgccgctcgacaatggcgctggcggcgaaggagcggcggctggaggacgcgatgttt
gctgagcagacaattcgcgccgagcagaggcaccaagatgacctgcggcgccagaaggag
tcgacccaggccgtcaaggcgtcattggacgggcaggtccaccacgtccgcgagcgccag
gccgctgaggcggaggcggacgcgcgcgaggttgccgccatgcgcgcccactgggagcgc
ctcgaggccgacgcggcagcggccgacgctgcggagcgcgagcggctgcggcggctggcg
gcggaggtcaaggaattcaacaggctcaagctcgcggagatgagcgccgcggagcgcagg
gagagggaattgaatctgcggatactgcaggatgcgctggccagggaggcggccgaggag
gcggcagaccaggcggcccgcgaggccaagcgccaggaggtgctgcactaccgccaccag
ctggcgctgtccatgcagcgcgaggcggaggcggcgggcgagcgggacttgctgatagag
cgcgccaaccgggagaagcaggcggcgcaggacgcggaatgggcggcgcgcgaggaggcg
cggcggcggctgatggcggaggtggacgccatacgcagggtgcagatcgcatacaagcag
gagcagaagcgtctgggcaaggagtcaaagcggcaggagctcgaccaggcgatcgccgca
gagcggcgcgaggaggcggaggccgccgcagccgcggcagaggcgcggcgcaaggcgctg
cagcagtcgctggacgtcaagacacaggtcatggcgcgggcgcacctccgcgcggccgcg
gcggaggacaaggtgcacgcggcagagctggcgcatgcgtccgaggagcgctacctgcag
cgcgtcgcggcggcggagcagcgcatcgcgccgcccacctttttcggtcgcaagaaggtc
gagtggatgcactga

DBGET integrated database retrieval system