Macaca nemestrina (pig-tailed macaque): 105463246 Help Entry 105463246         CDS       T08765                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni04814   Motor proteins mni05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mni00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     105463246 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105463246 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mni03037]     105463246 (DYNLT3)    04812 Cytoskeleton proteins [BR:mni04812]     105463246 (DYNLT3) Cilium and associated proteins [BR:mni03037]  Motile cilia and associated proteins   Dynein arm    105463246 (DYNLT3) Cytoskeleton proteins [BR:mni04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      105463246 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  105463246 NCBI-ProteinID:  XP_011708563 Ensembl:  ENSMNEG00000007117 UniProt:  A0A2K6AR08 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGK AYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggagtaccatcgccactgcgacgaggttggcttcaatgctgaggaagcccacaat attgtcaaagagtgtgtagatggggttttaggtggtgaagattataatcacaacaacatc aaccagtggaccgcaagcatagtggaacaatccttaacacatttggttaagttgggaaaa gcttataaatatattgtgacctgtgcagtggtccagaagagcgcatatggctttcacaca gccagctcctgcttttgggataccacatctgatggaacctgtaccgtaagatgggagaac cggaccatgaactgtattgtcaatgtttttgccattgctattgttctttaa

DBGET integrated database retrieval system