Macaca nemestrina (pig-tailed macaque): 105463673 Help Entry 105463673         CDS       T08765                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni04015   Rap1 signaling pathway mni04810   Regulation of actin cytoskeleton mni05014   Amyotrophic lateral sclerosis mni05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mni00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     105463673 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105463673 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105463673 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105463673 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mni04131]     105463673 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mni04812]     105463673 (PFN2)    04147 Exosome [BR:mni04147]     105463673 (PFN2) Membrane trafficking [BR:mni04131]  Others   Actin-binding proteins    Others     105463673 (PFN2) Cytoskeleton proteins [BR:mni04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      105463673 (PFN2) Exosome [BR:mni04147]  Exosomal proteins   Proteins found in most exosomes    105463673 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  105463673 NCBI-ProteinID:  XP_011709193 Ensembl:  ENSMNEG00000003253 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttt cagagcattacgccaatagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcgaagaaatgctcagtgatcagagatagtctatacgtc gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaat gttgctgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system