Macaca nemestrina (pig-tailed macaque): 105465432 Help Entry 105465432         CDS       T08765                                  Symbol RAB1A Name (RefSeq) ras-related protein Rab-1A   KO K07874   Ras-related protein Rab-1A Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni04140   Autophagy - animal mni05014   Amyotrophic lateral sclerosis mni05022   Pathways of neurodegeneration - multiple diseases mni05134   Legionellosis Brite KEGG Orthology (KO) [BR:mni00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105465432 (RAB1A)  09160 Human Diseases   09171 Infectious disease: bacterial    05134 Legionellosis     105465432 (RAB1A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105465432 (RAB1A)    05022 Pathways of neurodegeneration - multiple diseases     105465432 (RAB1A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mni04131]     105465432 (RAB1A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mni04147]     105465432 (RAB1A)    04031 GTP-binding proteins [BR:mni04031]     105465432 (RAB1A) Membrane trafficking [BR:mni04131]  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Rab GTPases     105465432 (RAB1A)  Autophagy   Other autophagy associated proteins     105465432 (RAB1A) Exosome [BR:mni04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105465432 (RAB1A)   Exosomal proteins of other body fluids (saliva and urine)    105465432 (RAB1A)   Exosomal proteins of colorectal cancer cells    105465432 (RAB1A) GTP-binding proteins [BR:mni04031]  Small (monomeric) G-proteins   Rab Family    Rab1/35 [OT]     105465432 (RAB1A) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA SRPRB RsgA_GTPase AAA_7 AAA_29 Septin AAA_16 ABC_tran AAA AAA_22 AAA_5 TniB Motif Other DBs NCBI-GeneID:  105465432 NCBI-ProteinID:  XP_024643421 LinkDB All DBs Position Unknown AA seq 198 aa AA seqDB search MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTI KLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQVSSKRRLCYSDQVGSHYSINVRFI YYFAYKPSVLTLWQKTLSTQIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEK SNVKIQSTPVKQSGGGCC NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgtccagcatgaatcccgaatatgattatttattcaagttacttctgattggcgactct ggggttggaaagtcttgccttcttcttaggtttgcagatgatacatatacagaaagctac atcagcacaattggtgtggatttcaaaataagaactatagagttagacgggaaaacaatc aagcttcaaatatgggacacagcaggccaggaaagatttcgaacaatcacctccagttat tacagaggagcccatggcatcatagttgtgtatgatgtgacagatcaggtaagttccaag aggagattgtgttacagtgaccaagtaggaagtcattattcgattaatgtaagattcatt tactacttcgcatataagccatcagtattaactttatggcagaaaactttgtccactcaa ataccgtttttggaaaccagtgctaagaatgcaacgaatgtagaacagtctttcatgacg atggcagctgagattaaaaagcgaatgggtcccggagcaacagctggtggtgctgagaag tccaatgttaaaattcagagcactccggtcaagcagtcaggtggaggttgctgctaa

DBGET integrated database retrieval system