Macaca nemestrina (pig-tailed macaque): 105467185 Help Entry 105467185         CDS       T08765                                  Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni04621   NOD-like receptor signaling pathway mni05012   Parkinson disease mni05132   Salmonella infection mni05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mni00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     105467185  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105467185   09164 Neurodegenerative disease    05012 Parkinson disease     105467185   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     105467185  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mni03110]     105467185 Chaperones and folding catalysts [BR:mni03110]  Protein folding catalysts   Protein disulfide isomerase    105467185 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 OST3_OST6 AhpC-TSA Thioredoxin_9 Thioredoxin_7 Glutaredoxin Redoxin Motif Other DBs NCBI-GeneID:  105467185 NCBI-ProteinID:  XP_011714964 Ensembl:  ENSMNEG00000015899 UniProt:  A0A2K6E687 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MVKQIESKAAFQEALNTAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagatcgagagcaaggctgcttttcaggaagccttgaacaccgcaggtgat aaacttgtagtagttgacttctcagccacgtggtgtgggccttgcaaaatgatcaagcct ttctttcattccctctctgaaaagtattccaacgtggtattccttgaagtagatgtggat gactgtcaggatgttgcttcagagtgtgaagtcaaatgcatgccaacattccagtttttt aagaagggacaaaaggtgggtgaattttctggagccaataaggaaaagcttgaagccacc attaatgaattagtctaa

DBGET integrated database retrieval system