Macaca nemestrina (pig-tailed macaque): 105468457 Help Entry 105468457         CDS       T08765                                  Symbol APLN Name (RefSeq) apelin   KO K05225   apelin Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni04080   Neuroactive ligand-receptor interaction mni04371   Apelin signaling pathway Brite KEGG Orthology (KO) [BR:mni00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     105468457 (APLN)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     105468457 (APLN)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mni04052]     105468457 (APLN) Cytokines and neuropeptides [BR:mni04052]  Neuropeptides   GPCR binding    105468457 (APLN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Apelin Motif Other DBs NCBI-GeneID:  105468457 NCBI-ProteinID:  XP_011716929 Ensembl:  ENSMNEG00000025745 UniProt:  A0A2K6B2K3 LinkDB All DBs Position Unknown AA seq 77 aa AA seqDB search MNLRLCVQALLLLWLSLTAVCGGPLMQLPYGNGLEEGNVRHLVQPRGSRNGPGPWQGGRR KFRRQRPRLSHKGPMPF NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaatctgcggctctgcgtgcaggcgctcctgctgctctggctctccttgaccgcggtg tgtggagggcccctgatgcagcttccctatgggaatgggctggaagagggcaatgtccgc cacctggtgcagcccagagggtcgaggaacgggccagggccctggcagggaggtcgaagg aaattccgccgccagcggccccgcctctcccataagggacccatgcctttctga

DBGET integrated database retrieval system