Macaca nemestrina (pig-tailed macaque): 105469173 Help Entry 105469173         CDS       T08765                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni04613   Neutrophil extracellular trap formation mni05034   Alcoholism mni05202   Transcriptional misregulation in cancer mni05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mni00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105469173  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     105469173   09163 Immune disease    05322 Systemic lupus erythematosus     105469173   09165 Substance dependence    05034 Alcoholism     105469173  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mni03036]     105469173   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mni04147]     105469173 Chromosome and associated proteins [BR:mni03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105469173 Exosome [BR:mni04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105469173 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  105469173 NCBI-ProteinID:  XP_011718175 Ensembl:  ENSMNEG00000028325 UniProt:  A0A2K6B875 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgaaccaagcagactgctcgtaaatccaccggtgggaaagcgccccgcaaacag ctggccacaaaagccgccaggaaaagcgctccctctaccggcggggtgaagaagcctcat cgctacaggcccgggaccgtggcgcttcgagagattcgccgttatcagaagtcgaccgag ctgctcattcggaagctgcccttccagaggttggtgagggagatcgctcaggatttcaaa accgacctgaggtttcagagcgcggccattggtgcgctgcaggaggccagtgaagcgtac ctggtgggtctgttcgaagatactaatctgtgtgccatccacgctaagagagtcaccatc atgcccaaagacatccagttggctcgccggatacggggagagagagcttaa

DBGET integrated database retrieval system