Macaca nemestrina (pig-tailed macaque): 105471785 Help Entry 105471785         CDS       T08765                                  Symbol IL1A Name (RefSeq) interleukin-1 alpha   KO K04383   interleukin 1 alpha Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni04010   MAPK signaling pathway mni04060   Cytokine-cytokine receptor interaction mni04217   Necroptosis mni04218   Cellular senescence mni04380   Osteoclast differentiation mni04640   Hematopoietic cell lineage mni04932   Non-alcoholic fatty liver disease mni04933   AGE-RAGE signaling pathway in diabetic complications mni04940   Type I diabetes mellitus mni05010   Alzheimer disease mni05020   Prion disease mni05022   Pathways of neurodegeneration - multiple diseases mni05133   Pertussis mni05140   Leishmaniasis mni05152   Tuberculosis mni05162   Measles mni05164   Influenza A mni05321   Inflammatory bowel disease mni05323   Rheumatoid arthritis mni05332   Graft-versus-host disease mni05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mni00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105471785 (IL1A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105471785 (IL1A)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105471785 (IL1A)    04218 Cellular senescence     105471785 (IL1A)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     105471785 (IL1A)   09158 Development and regeneration    04380 Osteoclast differentiation     105471785 (IL1A)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     105471785 (IL1A)    05162 Measles     105471785 (IL1A)   09171 Infectious disease: bacterial    05133 Pertussis     105471785 (IL1A)    05152 Tuberculosis     105471785 (IL1A)   09174 Infectious disease: parasitic    05140 Leishmaniasis     105471785 (IL1A)   09163 Immune disease    05323 Rheumatoid arthritis     105471785 (IL1A)    05321 Inflammatory bowel disease     105471785 (IL1A)    05332 Graft-versus-host disease     105471785 (IL1A)   09164 Neurodegenerative disease    05010 Alzheimer disease     105471785 (IL1A)    05020 Prion disease     105471785 (IL1A)    05022 Pathways of neurodegeneration - multiple diseases     105471785 (IL1A)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     105471785 (IL1A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     105471785 (IL1A)    04932 Non-alcoholic fatty liver disease     105471785 (IL1A)    04933 AGE-RAGE signaling pathway in diabetic complications     105471785 (IL1A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mni04052]     105471785 (IL1A) Cytokines and neuropeptides [BR:mni04052]  Cytokines   Interleukins    105471785 (IL1A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  105471785 NCBI-ProteinID:  XP_011722811 Ensembl:  ENSMNEG00000040187 LinkDB All DBs Position Unknown AA seq 271 aa AA seqDB search MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYDVSYGPLYEGCMDQSVSLSISEIS KTSKLTFKQSIVVVSTNGKVLKKRRLSLSQSITDNNLEAIANDSEEEIIKPRSAPFSFLS NMTYHFIRIIKHEFILNDTLNQTIIRANDQYLTAAAIHNLDEAVKFDMGAYMSSKDDTKV PVILRISKTQLYVSAQDEDQPVLLKEMPEIPKTITGSDTNFLFFWETHGTKNYFVSVAHP NLFIATKHDNWVCLAKGLPSITDFQILENQA NT seq 816 nt NT seq  +upstreamnt  +downstreamnt atggccaaagttccggacatgtttgaagacctgaagaactgttacagtgaaaatgaagaa gacagttcctccattgaccatctgtctctgaatcagaaatccttctatgatgtaagctat ggcccactctatgaaggctgcatggatcagtctgtgtctctgagtatctctgaaatctct aaaacatccaagctgaccttcaagcagagcatagtggtagtatcaaccaatgggaaggtt ctgaagaagagacggttgagtttaagccagtccatcactgataataacctggaggccatc gccaacgactcagaggaagaaatcatcaagcccaggtcggcaccttttagcttcctaagc aatatgacataccactttataaggatcatcaaacacgaattcatcctgaatgacaccctc aatcaaactataattcgagccaatgatcagtacctcacggctgctgcaatacataatctg gatgaagcagtgaaatttgacatgggtgcttatatgtcatcaaaggatgatactaaagtt cctgtgattctaagaatctcaaaaactcaattgtatgtgagtgcccaagatgaagaccaa ccggtgctgctgaaggagatgcctgagatacccaaaaccatcacaggtagtgacaccaac ttcctcttcttctgggaaactcatggcactaagaactacttcgtatcagttgcccatcca aacttgtttattgccacaaagcatgacaattgggtgtgcttggcaaaggggctaccctct atcactgactttcagatactggaaaaccaggcttag

DBGET integrated database retrieval system