Macaca nemestrina (pig-tailed macaque): 105472415 Help Entry 105472415         CDS       T08765                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni04081   Hormone signaling mni04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:mni00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     105472415 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     105472415 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mni04052]     105472415 (GAST) Cytokines and neuropeptides [BR:mni04052]  Neuropeptides   GPCR binding    105472415 (GAST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  105472415 NCBI-ProteinID:  XP_011723961 Ensembl:  ENSMNEG00000041907 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search YVLIFALALAAFSEASWKPRSQQPDAPLGTGANRNLELPWLDQQGPVSHHRRQLGPQGPP HLVADPSKKQGPWMEEEEAAYGWMDFGRRSAEDENQQP NT seq 297 nt NT seq  +upstreamnt  +downstreamnt tatgtgctgatctttgcactggctctggctgccttctctgaagcttcttggaagccccgc tcccagcagccagatgcacccttaggtacaggggccaacaggaacctggagctaccctgg ctggaccagcaaggcccagtctctcaccaccgaaggcagctgggaccccagggtccccca cacctcgtggcagacccatccaagaagcagggaccatggatggaggaagaagaagcagcc tatggatggatggactttggccgccgcagtgccgaggatgagaaccaacaaccctag

DBGET integrated database retrieval system