Macaca nemestrina (pig-tailed macaque): 105474165 Help Entry 105474165         CDS       T08765                                  Symbol RAB5B Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni04014   Ras signaling pathway mni04137   Mitophagy - animal mni04144   Endocytosis mni04145   Phagosome mni04148   Efferocytosis mni04962   Vasopressin-regulated water reabsorption mni05132   Salmonella infection mni05146   Amoebiasis mni05152   Tuberculosis Brite KEGG Orthology (KO) [BR:mni00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     105474165 (RAB5B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105474165 (RAB5B)    04145 Phagosome     105474165 (RAB5B)    04137 Mitophagy - animal     105474165 (RAB5B)    04148 Efferocytosis     105474165 (RAB5B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     105474165 (RAB5B)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105474165 (RAB5B)    05152 Tuberculosis     105474165 (RAB5B)   09174 Infectious disease: parasitic    05146 Amoebiasis     105474165 (RAB5B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mni04131]     105474165 (RAB5B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mni04147]     105474165 (RAB5B)    04031 GTP-binding proteins [BR:mni04031]     105474165 (RAB5B) Membrane trafficking [BR:mni04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     105474165 (RAB5B)  Endosome - Lysosome transport     105474165 (RAB5B) Exosome [BR:mni04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105474165 (RAB5B)   Exosomal proteins of other body fluids (saliva and urine)    105474165 (RAB5B)   Exosomal proteins of colorectal cancer cells    105474165 (RAB5B)   Exosomal proteins of melanoma cells    105474165 (RAB5B) GTP-binding proteins [BR:mni04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     105474165 (RAB5B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  105474165 NCBI-ProteinID:  XP_011726938 Ensembl:  ENSMNEG00000005338 UniProt:  A0A2K6APS0 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNLGGTACRSRGVDLHEQSQQNKSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgactagcagaagcacagctaggcccaatgggcaaccccaggccagcaaaatttgccag ttcaaattggtgctgctgggagaatctgcagtgggaaagtcaagcctggtgttacgtttt gtcaaagggcagttccatgagtaccaggagagcaccattggagcggccttccttacccag tccgtttgtctagatgacacaacagtcaagtttgagatctgggacacagctgggcaggag cgatatcacagcttagcccctatgtactacaggggtgcccaagctgcaatcgtggtttac gacattactaatcaggaaacctttgctcgagcaaagacatgggtgaaggaactacagcga caggccagtcctagcatcgttattgccctggcagggaacaaagctgacctggctaacaag cgtatggtggagtatgaagaggcccaggcatatgcagatgacaacagcttattgttcatg gagacttcagccaagacggctatgaacgtgaatgatctcttcctggcaatagctaagaag ttgccaaagagtgaaccccagaatctgggaggtacagcatgccgaagccggggtgtggat ctccatgaacagtcccagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system