Macaca nemestrina (pig-tailed macaque): 105474923 Help Entry 105474923         CDS       T08765                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni04072   Phospholipase D signaling pathway mni04140   Autophagy - animal mni04150   mTOR signaling pathway mni04151   PI3K-Akt signaling pathway mni04152   AMPK signaling pathway mni04211   Longevity regulating pathway mni04218   Cellular senescence mni04714   Thermogenesis mni04910   Insulin signaling pathway mni04919   Thyroid hormone signaling pathway mni05163   Human cytomegalovirus infection mni05165   Human papillomavirus infection mni05168   Herpes simplex virus 1 infection mni05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:mni00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     105474923 (RHEB)    04151 PI3K-Akt signaling pathway     105474923 (RHEB)    04152 AMPK signaling pathway     105474923 (RHEB)    04150 mTOR signaling pathway     105474923 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105474923 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     105474923 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     105474923 (RHEB)    04919 Thyroid hormone signaling pathway     105474923 (RHEB)   09149 Aging    04211 Longevity regulating pathway     105474923 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     105474923 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     105474923 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     105474923 (RHEB)    05163 Human cytomegalovirus infection     105474923 (RHEB)    05165 Human papillomavirus infection     105474923 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mni04031]     105474923 (RHEB) GTP-binding proteins [BR:mni04031]  Small (monomeric) G-proteins   Ras Family    Rheb     105474923 (RHEB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 DUF1842 Motif Other DBs NCBI-GeneID:  105474923 NCBI-ProteinID:  XP_011728146 Ensembl:  ENSMNEG00000042255 UniProt:  A0A2K6DRJ2 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKMDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc tcattgacgattcaatttgtcgaaggccaatttgtggactcctacgatccaaccatagaa aacacttttacaaagttgatcacagtaaatggacaagaatatcatcttcaacttgtagac acagctgggcaagatgaatattctatctttcctcagacctactccatagatattaatggc tatattcttgtgtattctgttacatcaatcaaaagttttgaagtgattaaagttatccat gggaaattattggatatggtggggaaagtacaaatacctattatgttggttgggaataag aaagacctgcatatggaaagggtgatcagttatgaagaagggaaagctttggcagaatct tggaatgcagcttttttggaatcttctgctaaagaaaatcagactgctgttgatgttttt agaaggataattttggaggcagaaaaaatggatggggcagcttcacaaggcaagtcttca tgctcggtgatgtga

DBGET integrated database retrieval system