Macaca nemestrina (pig-tailed macaque): 105478092 Help Entry 105478092         CDS       T08765                                  Name (RefSeq) cofilin-1   KO K05765   cofilin Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni04360   Axon guidance mni04666   Fc gamma R-mediated phagocytosis mni04810   Regulation of actin cytoskeleton mni05133   Pertussis mni05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:mni00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105478092  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     105478092   09158 Development and regeneration    04360 Axon guidance     105478092  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105478092   09171 Infectious disease: bacterial    05133 Pertussis     105478092  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mni04131]     105478092   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mni04812]     105478092    04147 Exosome [BR:mni04147]     105478092 Membrane trafficking [BR:mni04131]  Others   Actin-binding proteins    Others     105478092 Cytoskeleton proteins [BR:mni04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      105478092 Exosome [BR:mni04147]  Exosomal proteins   Proteins found in most exosomes    105478092 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  105478092 NCBI-ProteinID:  XP_011733370 UniProt:  A0A2K6C853 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPECAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctccggtgtggctgtctctgatggtgtcatcaaggtgttcaacgacatgaaggtg cgtaagtcttcaacgccagaggaggtgaagaagcgcaagaaggcggtgctcttctgcctg agtgaggacaagaagaacatcatcctggaggagggcaaggagatcttggtgggcgatgtg ggccagactgtcgacgacccctatgccacctttgtcaagatgctgccagacaaggactgc cgctacgccctctatgacgcaacctatgagaccaaggagagcaagaaggaggacctggtg tttattttctgggcccctgagtgtgcgccccttaagagcaaaatgatctatgccagttcc aaggatgccatcaagaagaagctgacagggatcaagcatgaattgcaagcaaactgctac gaggaagtcaaggaccgctgcaccctggcagagaagttggggggcagtgctgtcatctcc ctggagggcaagcctttgtga

DBGET integrated database retrieval system