Macaca nemestrina (pig-tailed macaque): 105479146 Help Entry 105479146         CDS       T08765                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni01521   EGFR tyrosine kinase inhibitor resistance mni01522   Endocrine resistance mni04010   MAPK signaling pathway mni04012   ErbB signaling pathway mni04014   Ras signaling pathway mni04015   Rap1 signaling pathway mni04062   Chemokine signaling pathway mni04068   FoxO signaling pathway mni04071   Sphingolipid signaling pathway mni04072   Phospholipase D signaling pathway mni04137   Mitophagy - animal mni04140   Autophagy - animal mni04150   mTOR signaling pathway mni04151   PI3K-Akt signaling pathway mni04210   Apoptosis mni04211   Longevity regulating pathway mni04213   Longevity regulating pathway - multiple species mni04218   Cellular senescence mni04360   Axon guidance mni04370   VEGF signaling pathway mni04371   Apelin signaling pathway mni04540   Gap junction mni04550   Signaling pathways regulating pluripotency of stem cells mni04625   C-type lectin receptor signaling pathway mni04650   Natural killer cell mediated cytotoxicity mni04660   T cell receptor signaling pathway mni04662   B cell receptor signaling pathway mni04664   Fc epsilon RI signaling pathway mni04714   Thermogenesis mni04720   Long-term potentiation mni04722   Neurotrophin signaling pathway mni04725   Cholinergic synapse mni04726   Serotonergic synapse mni04730   Long-term depression mni04810   Regulation of actin cytoskeleton mni04910   Insulin signaling pathway mni04912   GnRH signaling pathway mni04915   Estrogen signaling pathway mni04916   Melanogenesis mni04917   Prolactin signaling pathway mni04919   Thyroid hormone signaling pathway mni04921   Oxytocin signaling pathway mni04926   Relaxin signaling pathway mni04929   GnRH secretion mni04933   AGE-RAGE signaling pathway in diabetic complications mni04935   Growth hormone synthesis, secretion and action mni05010   Alzheimer disease mni05022   Pathways of neurodegeneration - multiple diseases mni05034   Alcoholism mni05160   Hepatitis C mni05161   Hepatitis B mni05163   Human cytomegalovirus infection mni05165   Human papillomavirus infection mni05166   Human T-cell leukemia virus 1 infection mni05167   Kaposi sarcoma-associated herpesvirus infection mni05170   Human immunodeficiency virus 1 infection mni05200   Pathways in cancer mni05203   Viral carcinogenesis mni05205   Proteoglycans in cancer mni05206   MicroRNAs in cancer mni05207   Chemical carcinogenesis - receptor activation mni05208   Chemical carcinogenesis - reactive oxygen species mni05210   Colorectal cancer mni05211   Renal cell carcinoma mni05213   Endometrial cancer mni05214   Glioma mni05215   Prostate cancer mni05216   Thyroid cancer mni05218   Melanoma mni05219   Bladder cancer mni05220   Chronic myeloid leukemia mni05221   Acute myeloid leukemia mni05223   Non-small cell lung cancer mni05224   Breast cancer mni05225   Hepatocellular carcinoma mni05226   Gastric cancer mni05230   Central carbon metabolism in cancer mni05231   Choline metabolism in cancer mni05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mni05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mni00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105479146 (NRAS)    04012 ErbB signaling pathway     105479146 (NRAS)    04014 Ras signaling pathway     105479146 (NRAS)    04015 Rap1 signaling pathway     105479146 (NRAS)    04370 VEGF signaling pathway     105479146 (NRAS)    04371 Apelin signaling pathway     105479146 (NRAS)    04068 FoxO signaling pathway     105479146 (NRAS)    04072 Phospholipase D signaling pathway     105479146 (NRAS)    04071 Sphingolipid signaling pathway     105479146 (NRAS)    04151 PI3K-Akt signaling pathway     105479146 (NRAS)    04150 mTOR signaling pathway     105479146 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105479146 (NRAS)    04137 Mitophagy - animal     105479146 (NRAS)   09143 Cell growth and death    04210 Apoptosis     105479146 (NRAS)    04218 Cellular senescence     105479146 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     105479146 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     105479146 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105479146 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105479146 (NRAS)    04650 Natural killer cell mediated cytotoxicity     105479146 (NRAS)    04660 T cell receptor signaling pathway     105479146 (NRAS)    04662 B cell receptor signaling pathway     105479146 (NRAS)    04664 Fc epsilon RI signaling pathway     105479146 (NRAS)    04062 Chemokine signaling pathway     105479146 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     105479146 (NRAS)    04929 GnRH secretion     105479146 (NRAS)    04912 GnRH signaling pathway     105479146 (NRAS)    04915 Estrogen signaling pathway     105479146 (NRAS)    04917 Prolactin signaling pathway     105479146 (NRAS)    04921 Oxytocin signaling pathway     105479146 (NRAS)    04926 Relaxin signaling pathway     105479146 (NRAS)    04935 Growth hormone synthesis, secretion and action     105479146 (NRAS)    04919 Thyroid hormone signaling pathway     105479146 (NRAS)    04916 Melanogenesis     105479146 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     105479146 (NRAS)    04726 Serotonergic synapse     105479146 (NRAS)    04720 Long-term potentiation     105479146 (NRAS)    04730 Long-term depression     105479146 (NRAS)    04722 Neurotrophin signaling pathway     105479146 (NRAS)   09158 Development and regeneration    04360 Axon guidance     105479146 (NRAS)   09149 Aging    04211 Longevity regulating pathway     105479146 (NRAS)    04213 Longevity regulating pathway - multiple species     105479146 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     105479146 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105479146 (NRAS)    05206 MicroRNAs in cancer     105479146 (NRAS)    05205 Proteoglycans in cancer     105479146 (NRAS)    05207 Chemical carcinogenesis - receptor activation     105479146 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     105479146 (NRAS)    05203 Viral carcinogenesis     105479146 (NRAS)    05230 Central carbon metabolism in cancer     105479146 (NRAS)    05231 Choline metabolism in cancer     105479146 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105479146 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     105479146 (NRAS)    05225 Hepatocellular carcinoma     105479146 (NRAS)    05226 Gastric cancer     105479146 (NRAS)    05214 Glioma     105479146 (NRAS)    05216 Thyroid cancer     105479146 (NRAS)    05221 Acute myeloid leukemia     105479146 (NRAS)    05220 Chronic myeloid leukemia     105479146 (NRAS)    05218 Melanoma     105479146 (NRAS)    05211 Renal cell carcinoma     105479146 (NRAS)    05219 Bladder cancer     105479146 (NRAS)    05215 Prostate cancer     105479146 (NRAS)    05213 Endometrial cancer     105479146 (NRAS)    05224 Breast cancer     105479146 (NRAS)    05223 Non-small cell lung cancer     105479146 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105479146 (NRAS)    05170 Human immunodeficiency virus 1 infection     105479146 (NRAS)    05161 Hepatitis B     105479146 (NRAS)    05160 Hepatitis C     105479146 (NRAS)    05163 Human cytomegalovirus infection     105479146 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     105479146 (NRAS)    05165 Human papillomavirus infection     105479146 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     105479146 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     105479146 (NRAS)   09165 Substance dependence    05034 Alcoholism     105479146 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105479146 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     105479146 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     105479146 (NRAS)    01522 Endocrine resistance     105479146 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mni04131]     105479146 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mni04147]     105479146 (NRAS)    04031 GTP-binding proteins [BR:mni04031]     105479146 (NRAS) Membrane trafficking [BR:mni04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     105479146 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     105479146 (NRAS) Exosome [BR:mni04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105479146 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    105479146 (NRAS)   Exosomal proteins of breast cancer cells    105479146 (NRAS)   Exosomal proteins of colorectal cancer cells    105479146 (NRAS) GTP-binding proteins [BR:mni04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     105479146 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  105479146 NCBI-ProteinID:  XP_011735271 Ensembl:  ENSMNEG00000044823 UniProt:  A0A2K6E8J4 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac agaaaacaggtggttatagatggtgaaacctgtttgttggacatactggatacagctgga caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaataatagcaagtcatttgcggatattaacctctacagggagcagatt aagcgagtaaaagactcagatgatgtacctatggtgctagtgggaaacaagtgtgatttg ccaacaaggacagttgatacaaaacaagcccacgaactggccaagagttacgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggta agagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggactcagggt tgtatgggattaccatgtgtggtgatgtaa

DBGET integrated database retrieval system