Macaca nemestrina (pig-tailed macaque): 105480439 Help Entry 105480439         CDS       T08765                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni04014   Ras signaling pathway mni04015   Rap1 signaling pathway mni04022   cGMP-PKG signaling pathway mni04024   cAMP signaling pathway mni04062   Chemokine signaling pathway mni04071   Sphingolipid signaling pathway mni04072   Phospholipase D signaling pathway mni04081   Hormone signaling mni04144   Endocytosis mni04150   mTOR signaling pathway mni04270   Vascular smooth muscle contraction mni04310   Wnt signaling pathway mni04350   TGF-beta signaling pathway mni04360   Axon guidance mni04510   Focal adhesion mni04517   IgSF CAM signaling mni04520   Adherens junction mni04530   Tight junction mni04611   Platelet activation mni04621   NOD-like receptor signaling pathway mni04625   C-type lectin receptor signaling pathway mni04660   T cell receptor signaling pathway mni04670   Leukocyte transendothelial migration mni04722   Neurotrophin signaling pathway mni04810   Regulation of actin cytoskeleton mni04921   Oxytocin signaling pathway mni04928   Parathyroid hormone synthesis, secretion and action mni04972   Pancreatic secretion mni05100   Bacterial invasion of epithelial cells mni05132   Salmonella infection mni05133   Pertussis mni05135   Yersinia infection mni05152   Tuberculosis mni05163   Human cytomegalovirus infection mni05200   Pathways in cancer mni05203   Viral carcinogenesis mni05205   Proteoglycans in cancer mni05206   MicroRNAs in cancer mni05210   Colorectal cancer mni05417   Lipid and atherosclerosis mni05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mni00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     105480439 (RHOA)    04015 Rap1 signaling pathway     105480439 (RHOA)    04310 Wnt signaling pathway     105480439 (RHOA)    04350 TGF-beta signaling pathway     105480439 (RHOA)    04072 Phospholipase D signaling pathway     105480439 (RHOA)    04071 Sphingolipid signaling pathway     105480439 (RHOA)    04024 cAMP signaling pathway     105480439 (RHOA)    04022 cGMP-PKG signaling pathway     105480439 (RHOA)    04150 mTOR signaling pathway     105480439 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     105480439 (RHOA)    04517 IgSF CAM signaling     105480439 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105480439 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     105480439 (RHOA)    04520 Adherens junction     105480439 (RHOA)    04530 Tight junction     105480439 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105480439 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     105480439 (RHOA)    04621 NOD-like receptor signaling pathway     105480439 (RHOA)    04625 C-type lectin receptor signaling pathway     105480439 (RHOA)    04660 T cell receptor signaling pathway     105480439 (RHOA)    04670 Leukocyte transendothelial migration     105480439 (RHOA)    04062 Chemokine signaling pathway     105480439 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     105480439 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     105480439 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     105480439 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     105480439 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     105480439 (RHOA)   09158 Development and regeneration    04360 Axon guidance     105480439 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105480439 (RHOA)    05206 MicroRNAs in cancer     105480439 (RHOA)    05205 Proteoglycans in cancer     105480439 (RHOA)    05203 Viral carcinogenesis     105480439 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     105480439 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     105480439 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     105480439 (RHOA)    05135 Yersinia infection     105480439 (RHOA)    05133 Pertussis     105480439 (RHOA)    05152 Tuberculosis     105480439 (RHOA)    05100 Bacterial invasion of epithelial cells     105480439 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105480439 (RHOA)    05418 Fluid shear stress and atherosclerosis     105480439 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mni04131]     105480439 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mni04147]     105480439 (RHOA)    04031 GTP-binding proteins [BR:mni04031]     105480439 (RHOA) Membrane trafficking [BR:mni04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     105480439 (RHOA) Exosome [BR:mni04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105480439 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    105480439 (RHOA)   Exosomal proteins of colorectal cancer cells    105480439 (RHOA)   Exosomal proteins of bladder cancer cells    105480439 (RHOA) GTP-binding proteins [BR:mni04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     105480439 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  105480439 NCBI-ProteinID:  XP_011737623 Ensembl:  ENSMNEG00000042186 UniProt:  A0A2K6DR79 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactagtgattgttggtgatggagcctgtggaaagacatgc ttgctcatagtcttcagcaaggatcagttcccagaggtgtatgtgcccacagtgtttgag aactatgtggcagatatcgaggtggatggaaaacaggtagagttggctttgtgggacaca gctgggcaggaagattatgatcgcctgaggcccctctcctacccagataccgatgttata ctgatgtgtttttccatcgacagccctgatagtttagaaaacatcccagaaaagtggacc ccggaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaataagaaggat cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccagtgaaa cctgaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagagaggtttttgaaatggctacgagagctgctctgcaa gctagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system