Macaca nemestrina (pig-tailed macaque): 105480992 Help Entry 105480992         CDS       T08765                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni04010   MAPK signaling pathway mni04020   Calcium signaling pathway mni04022   cGMP-PKG signaling pathway mni04114   Oocyte meiosis mni04218   Cellular senescence mni04310   Wnt signaling pathway mni04360   Axon guidance mni04370   VEGF signaling pathway mni04380   Osteoclast differentiation mni04625   C-type lectin receptor signaling pathway mni04650   Natural killer cell mediated cytotoxicity mni04658   Th1 and Th2 cell differentiation mni04659   Th17 cell differentiation mni04660   T cell receptor signaling pathway mni04662   B cell receptor signaling pathway mni04720   Long-term potentiation mni04724   Glutamatergic synapse mni04921   Oxytocin signaling pathway mni04922   Glucagon signaling pathway mni04924   Renin secretion mni05010   Alzheimer disease mni05014   Amyotrophic lateral sclerosis mni05020   Prion disease mni05022   Pathways of neurodegeneration - multiple diseases mni05031   Amphetamine addiction mni05152   Tuberculosis mni05163   Human cytomegalovirus infection mni05166   Human T-cell leukemia virus 1 infection mni05167   Kaposi sarcoma-associated herpesvirus infection mni05170   Human immunodeficiency virus 1 infection mni05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mni05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mni00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105480992 (PPP3R2)    04310 Wnt signaling pathway     105480992 (PPP3R2)    04370 VEGF signaling pathway     105480992 (PPP3R2)    04020 Calcium signaling pathway     105480992 (PPP3R2)    04022 cGMP-PKG signaling pathway     105480992 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     105480992 (PPP3R2)    04218 Cellular senescence     105480992 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105480992 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     105480992 (PPP3R2)    04660 T cell receptor signaling pathway     105480992 (PPP3R2)    04658 Th1 and Th2 cell differentiation     105480992 (PPP3R2)    04659 Th17 cell differentiation     105480992 (PPP3R2)    04662 B cell receptor signaling pathway     105480992 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     105480992 (PPP3R2)    04921 Oxytocin signaling pathway     105480992 (PPP3R2)    04924 Renin secretion     105480992 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     105480992 (PPP3R2)    04720 Long-term potentiation     105480992 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     105480992 (PPP3R2)    04380 Osteoclast differentiation     105480992 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105480992 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105480992 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     105480992 (PPP3R2)    05163 Human cytomegalovirus infection     105480992 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     105480992 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     105480992 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     105480992 (PPP3R2)    05014 Amyotrophic lateral sclerosis     105480992 (PPP3R2)    05020 Prion disease     105480992 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     105480992 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     105480992 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105480992 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mni01009]     105480992 (PPP3R2) Protein phosphatases and associated proteins [BR:mni01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      105480992 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 YtfJ_HI0045 flgK_1st_1 Motif Other DBs NCBI-GeneID:  105480992 NCBI-ProteinID:  XP_011738534 LinkDB All DBs Position Unknown AA seq 173 aa AA seqDB search MSTMGNEASYPAEMCAHFDNDEIKRLGRRFRKLDLDKSGSLSVEEFMSLPELRHNPLVRR VIDVFDTNDDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLK MMVGNNLPDWQLQQLVDKTILILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atgtccacaatgggaaacgaggccagttacccggcggagatgtgcgcccactttgacaat gatgaaattaaaaggctgggcaggaggtttcggaagttggacttggacaaatcaggctct ctgagcgtggaggagttcatgtccctgccggagctgcgccacaacccgttggtgcggcga gtgatcgacgtcttcgacaccaacgacgatggagaagtggacttcaaggaattcatcctg gggacctctcagttcagcgtcaagggcgacgaggagcagaagttgaggtttgcgtttagc atttacgacatggataaagatggctacatttccaacggggagctcttccaggtgctgaag atgatggtgggcaacaacctgccggactggcagctccagcagctggtcgacaaaaccatc ctcatcctggacaaggatggcgatgggaagatatcctttgaggaattcagtgctgtggtc agagacctggagatccacaagaagctggtcctcatcgtgtga

DBGET integrated database retrieval system