Macaca nemestrina (pig-tailed macaque): 105482585 Help Entry 105482585         CDS       T08765                                  Name (RefSeq) histone H2B type 1-like   KO K11252   histone H2B Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni04613   Neutrophil extracellular trap formation mni05034   Alcoholism mni05203   Viral carcinogenesis mni05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mni00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105482585  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     105482585   09163 Immune disease    05322 Systemic lupus erythematosus     105482585   09165 Substance dependence    05034 Alcoholism     105482585  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mni03036]     105482585   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mni04147]     105482585 Chromosome and associated proteins [BR:mni03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105482585 Exosome [BR:mni04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105482585 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  105482585 NCBI-ProteinID:  XP_011741087 Ensembl:  ENSMNEG00000017009 LinkDB All DBs Position Unknown AA seq 143 aa AA seqDB search MRCRFHFDSYLQNSEGSMPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVY KVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLL PGELAKHAVSEGTKAVTKYTSSK NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgagatgtagatttcattttgattcctacttgcagaacagcgaaggtagcatgcctgag ccagcgaaatccgctccggccccaaagaagggctccaaaaaggccgtgaccaaggcgcag aagaaggacggcaagaagcgcaagcgcagccgtaaggagagctactccgtatacgtgtac aaggtgctgaaacaggtccatcccgacaccggcatctcctccaaagccatggggatcatg aattcctttgtcaacgacatcttcgagcgcatcgctggcgaggcttcccgcctggcgcat tacaacaagcgctcgaccatcacctccagggagatccagacggccgtgcgcctgctgctg cccggggagctggccaagcacgccgtgtcggagggcaccaaggccgtcaccaagtacacg agctccaagtaa

DBGET integrated database retrieval system