Macaca nemestrina (pig-tailed macaque): 105482638 Help Entry 105482638         CDS       T08765                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni04613   Neutrophil extracellular trap formation mni05034   Alcoholism mni05202   Transcriptional misregulation in cancer mni05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mni00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105482638  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     105482638   09163 Immune disease    05322 Systemic lupus erythematosus     105482638   09165 Substance dependence    05034 Alcoholism     105482638  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mni03036]     105482638   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mni04147]     105482638 Chromosome and associated proteins [BR:mni03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105482638 Exosome [BR:mni04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105482638 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  105482638 NCBI-ProteinID:  XP_024648759 Ensembl:  ENSMNEG00000015321 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtactaagcaaactgctcggaagtctactggtggaaaggcgccacgcaaacag ttggccactaaggcagcccgcaagagtgctccggccaccggcggtgtgaaaaagccccac cgctaccggcccggtactgtggctctgcgcgagatccgccgttatcagaagtctaccgaa ctgctgatacgtaaactacctttccagcgcctagtgcgcgagattgcgcaggacttcaaa acagacctgcgcttccagagctctgctgtgatggctctgcaggaggcgtgcgaggcctac ttagttgggctgtttgaggacactaatctgtgcgccatccacgccaagcgcgtcactatc atgcccaaggacatccagctggctcgccgcatccgcggagagcgggcatga

DBGET integrated database retrieval system