Macaca nemestrina (pig-tailed macaque): 105484052 Help Entry 105484052         CDS       T08765                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni04015   Rap1 signaling pathway mni04810   Regulation of actin cytoskeleton mni05014   Amyotrophic lateral sclerosis mni05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mni00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     105484052 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105484052 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105484052 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105484052 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mni04131]     105484052 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mni04812]     105484052 (PFN3)    04147 Exosome [BR:mni04147]     105484052 (PFN3) Membrane trafficking [BR:mni04131]  Others   Actin-binding proteins    Others     105484052 (PFN3) Cytoskeleton proteins [BR:mni04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      105484052 (PFN3) Exosome [BR:mni04147]  Exosomal proteins   Proteins found in most exosomes    105484052 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  105484052 NCBI-ProteinID:  XP_011743553 Ensembl:  ENSMNEG00000021788 UniProt:  A0A2K6B045 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRCTFL QAGLSVGGRRCCVIRDHLLAEGDGVLDARTKGLDPRAVCVGHAPRALLVLMGRRGVHGGI LNKTVHELIRGLRMQGA NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgactggaaggtctacatcagtgcagtgttgcgggaccagcgcatcgacgacgtg gccatcgtgggccatgcggataacagctgcgtgtgggcttcgcggcccgggggcctgctg gctgctatctcgccgcaggaggtgggcgtgctcacggggcccgaccgttgcaccttcctg caggcgggcctgagcgtgggcggccgccgctgctgcgtcatccgcgaccacctgctggcc gagggcgacggcgtgctggacgcacgcaccaagggactggacccgcgcgccgtgtgcgtg ggccacgcgccgcgcgcgctcctggtgctcatgggccgacgcggcgtccatgggggcatc ctgaacaagacggtgcacgaactcatacgcgggctgcgcatgcagggcgcctag

DBGET integrated database retrieval system