Macaca nemestrina (pig-tailed macaque): 105488903 Help Entry 105488903         CDS       T08765                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni04014   Ras signaling pathway mni04137   Mitophagy - animal mni04144   Endocytosis mni04145   Phagosome mni04148   Efferocytosis mni04962   Vasopressin-regulated water reabsorption mni05014   Amyotrophic lateral sclerosis mni05022   Pathways of neurodegeneration - multiple diseases mni05132   Salmonella infection mni05146   Amoebiasis mni05152   Tuberculosis Brite KEGG Orthology (KO) [BR:mni00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     105488903 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105488903 (RAB5A)    04145 Phagosome     105488903 (RAB5A)    04137 Mitophagy - animal     105488903 (RAB5A)    04148 Efferocytosis     105488903 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     105488903 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105488903 (RAB5A)    05152 Tuberculosis     105488903 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     105488903 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105488903 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     105488903 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mni04131]     105488903 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mni04147]     105488903 (RAB5A)    04031 GTP-binding proteins [BR:mni04031]     105488903 (RAB5A) Membrane trafficking [BR:mni04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     105488903 (RAB5A)  Endosome - Lysosome transport     105488903 (RAB5A) Exosome [BR:mni04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105488903 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    105488903 (RAB5A)   Exosomal proteins of colorectal cancer cells    105488903 (RAB5A)   Exosomal proteins of bladder cancer cells    105488903 (RAB5A) GTP-binding proteins [BR:mni04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     105488903 (RAB5A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  105488903 NCBI-ProteinID:  XP_011751711 Ensembl:  ENSMNEG00000039149 UniProt:  A0A2K6D6C1 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggcgcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttggcaaatcaagcctagtgcttcgtttt gtgaaaggccaatttcatgaatttcaagagagtaccattggggctgcttttctaacccaa actgtatgtcttgatgacactacagtaaagtttgaaatatgggatacagctggtcaagaa cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat gatatcacaaatgaggagtcctttgcaagagcaaaaaattgggttaaagaacttcagagg caagcaagtcctaacattgtaatagctttatcaggaaacaaggccgacctagcaaataaa agagcagtagatttccaggaagcacagtcctatgcagatgacaatagtttattattcatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaaa ttgccaaagaatgaaccacaaaatccaggagcaaattctgccagaggaagaggagtagat ctcaccgaacccacacaaccaaccaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system