Macaca nemestrina (pig-tailed macaque): 105492091 Help Entry 105492091         CDS       T08765                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni04613   Neutrophil extracellular trap formation mni05034   Alcoholism mni05202   Transcriptional misregulation in cancer mni05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mni00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105492091  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     105492091   09163 Immune disease    05322 Systemic lupus erythematosus     105492091   09165 Substance dependence    05034 Alcoholism     105492091  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mni03036]     105492091   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mni04147]     105492091 Chromosome and associated proteins [BR:mni03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105492091 Exosome [BR:mni04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105492091 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF Motif Other DBs NCBI-GeneID:  105492091 NCBI-ProteinID:  XP_011757284 Ensembl:  ENSMNEG00000024936 LinkDB All DBs Position Unknown AA seq 138 aa AA seqDB search MAPTKQTARFVPSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKS TELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRV TIMPKDIQLARRIRGERA NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atggctcctacaaagcagactgcccgctttgtaccatcgaccggtggtaaagcacccagg aagcaactggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaa cctcatcgttacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtcc actgaacttctgattcgcaaacttcccttccagcgtctggtgcgagaaattgctcaggac tttaaaacagatctgcgcttccagagcgcagctattggtgctttgcaggaggcaagtgag gcctatctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgta acaattatgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system