Macaca nemestrina (pig-tailed macaque): 105493781 Help Entry 105493781         CDS       T08765                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni04140   Autophagy - animal mni04144   Endocytosis mni04152   AMPK signaling pathway mni04530   Tight junction mni04972   Pancreatic secretion mni05014   Amyotrophic lateral sclerosis mni05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:mni00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     105493781 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105493781 (RAB8A)    04140 Autophagy - animal     105493781 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     105493781 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     105493781 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105493781 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     105493781 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mni04131]     105493781 (RAB8A)    03036 Chromosome and associated proteins [BR:mni03036]     105493781 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mni04147]     105493781 (RAB8A)    04031 GTP-binding proteins [BR:mni04031]     105493781 (RAB8A) Membrane trafficking [BR:mni04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     105493781 (RAB8A)  Autophagy   Other autophagy associated proteins     105493781 (RAB8A) Chromosome and associated proteins [BR:mni03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     105493781 (RAB8A) Exosome [BR:mni04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105493781 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    105493781 (RAB8A)   Exosomal proteins of colorectal cancer cells    105493781 (RAB8A) GTP-binding proteins [BR:mni04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     105493781 (RAB8A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 DUF3963 Septin AAA_7 Motif Other DBs NCBI-GeneID:  105493781 NCBI-ProteinID:  XP_011760026 Ensembl:  ENSMNEG00000044260 UniProt:  A0A2K6E4N4 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSNQGVKITPDQQKRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactccacttttatctccacc ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaaactgcag atatgggacacggctggtcaggaacggtttcggacgatcacaacggcctactacaggggc gcaatgggcatcatgctggtgtacgacatcaccaacgagaagtccttcgacaacatccgg aactggattcgcaacattgaggagcacgcctctgcagacgtcgaaaagatgatactcggg aacaagtgtgatgtgaatgacaagagacaagtttccaaggaacggggagaaaagctggcc ctcgactatggaatcaagttcatggagaccagcgcgaaggccaacattaacgtggaaaat gcatttttcactctggccagagacatcaaagcaaaaatggacaaaaaattggaaggcaac agcccccaggggagcaaccagggagtcaaaatcacaccggaccagcagaagaggagcagc tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system