Macaca nemestrina (pig-tailed macaque): 105494058 Help Entry 105494058         CDS       T08765                                  Name (RefSeq) metallothionein-2-like   KO K14739   metallothionein 1/2 Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni04978   Mineral absorption Brite KEGG Orthology (KO) [BR:mni00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     105494058  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mni03019]     105494058    03029 Mitochondrial biogenesis [BR:mni03029]     105494058 Messenger RNA biogenesis [BR:mni03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      105494058 Mitochondrial biogenesis [BR:mni03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     105494058 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  105494058 NCBI-ProteinID:  XP_011760464 LinkDB All DBs Position Unknown AA seq 61 aa AA seqDB search MDPNCSCSAGDSCTCADSCKCKECTCPSCKKSCCSCCPVGCAKCAQGCICKGALDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgctccgctggtgactcctgcacctgcgccgactcctgcaag tgcaaagagtgcacatgcccctcctgcaagaagagctgctgctcctgctgccctgtgggc tgtgccaagtgtgctcagggctgcatctgcaaaggggccttggacaagtgcagctgctgt gcctga

DBGET integrated database retrieval system