Macaca nemestrina (pig-tailed macaque): 105495146 Help Entry 105495146         CDS       T08765                                  Symbol JUN Name (RefSeq) transcription factor AP-1   KO K04448   transcription factor AP-1 Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni01522   Endocrine resistance mni04010   MAPK signaling pathway mni04012   ErbB signaling pathway mni04024   cAMP signaling pathway mni04137   Mitophagy - animal mni04210   Apoptosis mni04310   Wnt signaling pathway mni04380   Osteoclast differentiation mni04510   Focal adhesion mni04530   Tight junction mni04620   Toll-like receptor signaling pathway mni04621   NOD-like receptor signaling pathway mni04625   C-type lectin receptor signaling pathway mni04657   IL-17 signaling pathway mni04658   Th1 and Th2 cell differentiation mni04659   Th17 cell differentiation mni04660   T cell receptor signaling pathway mni04662   B cell receptor signaling pathway mni04668   TNF signaling pathway mni04722   Neurotrophin signaling pathway mni04912   GnRH signaling pathway mni04915   Estrogen signaling pathway mni04921   Oxytocin signaling pathway mni04926   Relaxin signaling pathway mni04932   Non-alcoholic fatty liver disease mni04933   AGE-RAGE signaling pathway in diabetic complications mni05030   Cocaine addiction mni05031   Amphetamine addiction mni05132   Salmonella infection mni05133   Pertussis mni05135   Yersinia infection mni05140   Leishmaniasis mni05142   Chagas disease mni05161   Hepatitis B mni05162   Measles mni05166   Human T-cell leukemia virus 1 infection mni05167   Kaposi sarcoma-associated herpesvirus infection mni05169   Epstein-Barr virus infection mni05170   Human immunodeficiency virus 1 infection mni05171   Coronavirus disease - COVID-19 mni05200   Pathways in cancer mni05203   Viral carcinogenesis mni05207   Chemical carcinogenesis - receptor activation mni05208   Chemical carcinogenesis - reactive oxygen species mni05210   Colorectal cancer mni05211   Renal cell carcinoma mni05224   Breast cancer mni05231   Choline metabolism in cancer mni05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mni05321   Inflammatory bowel disease mni05323   Rheumatoid arthritis mni05417   Lipid and atherosclerosis mni05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mni00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105495146 (JUN)    04012 ErbB signaling pathway     105495146 (JUN)    04310 Wnt signaling pathway     105495146 (JUN)    04668 TNF signaling pathway     105495146 (JUN)    04024 cAMP signaling pathway     105495146 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     105495146 (JUN)   09143 Cell growth and death    04210 Apoptosis     105495146 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     105495146 (JUN)    04530 Tight junction     105495146 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105495146 (JUN)    04621 NOD-like receptor signaling pathway     105495146 (JUN)    04625 C-type lectin receptor signaling pathway     105495146 (JUN)    04660 T cell receptor signaling pathway     105495146 (JUN)    04658 Th1 and Th2 cell differentiation     105495146 (JUN)    04659 Th17 cell differentiation     105495146 (JUN)    04657 IL-17 signaling pathway     105495146 (JUN)    04662 B cell receptor signaling pathway     105495146 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     105495146 (JUN)    04915 Estrogen signaling pathway     105495146 (JUN)    04921 Oxytocin signaling pathway     105495146 (JUN)    04926 Relaxin signaling pathway     105495146 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     105495146 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     105495146 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105495146 (JUN)    05207 Chemical carcinogenesis - receptor activation     105495146 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     105495146 (JUN)    05203 Viral carcinogenesis     105495146 (JUN)    05231 Choline metabolism in cancer     105495146 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105495146 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     105495146 (JUN)    05211 Renal cell carcinoma     105495146 (JUN)    05224 Breast cancer     105495146 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105495146 (JUN)    05170 Human immunodeficiency virus 1 infection     105495146 (JUN)    05161 Hepatitis B     105495146 (JUN)    05171 Coronavirus disease - COVID-19     105495146 (JUN)    05162 Measles     105495146 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     105495146 (JUN)    05169 Epstein-Barr virus infection     105495146 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     105495146 (JUN)    05135 Yersinia infection     105495146 (JUN)    05133 Pertussis     105495146 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     105495146 (JUN)    05142 Chagas disease     105495146 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     105495146 (JUN)    05321 Inflammatory bowel disease     105495146 (JUN)   09165 Substance dependence    05030 Cocaine addiction     105495146 (JUN)    05031 Amphetamine addiction     105495146 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105495146 (JUN)    05418 Fluid shear stress and atherosclerosis     105495146 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     105495146 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     105495146 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     105495146 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mni03000]     105495146 (JUN) Transcription factors [BR:mni03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     105495146 (JUN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf Rab11-FIP3 RIMB1_N ZapB PspA_IM30 Fib_alpha DUF3450 FlaC_arch TFIIA Motif Other DBs NCBI-GeneID:  105495146 NCBI-ProteinID:  XP_011762699 LinkDB All DBs Position Unknown AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLPSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQQQQPPPQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctatgatgatgccctcaacgcctcgttcctcccg tccgagagcggagcttatggctacagtaaccccaagatcctgaaacagagcatgaccctg aacctggccgacccagtggggagcctgaagccgcacctccgcgccaagaactcggacctc ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgcccc aagaacgtgacagacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtcagcggcgcagccggtcagcggggcg ggcatggtagctccagcggtagcctcggtggcagggggcagcggcagcggaggcttcagc gccagcctgcacagcgagccgcccgtctacgccaacctcagcaacttcaacccaggcgcg ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcaa ccccagcagcagcagccgccgccgcagccgccgcaccacctgccccagcagatgcccgtg cagcacccgcggctgcaagccctgaaggaggagcctcagacagtgcccgagatgcctggc gagacgccgcccctgtcccccattgacatggagtcccaggagcggatcaaggcggagagg aagcgtatgaggaaccgcattgctgcctccaagtgccgaaaaaggaagctggagagaatc gcccggctggaggaaaaagtgaaaaccttgaaagctcagaactcggagctggcgtccacg gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac agtgggtgccaactcatgctaacgcagcagttgcaaacattttga

DBGET integrated database retrieval system