Macaca nemestrina (pig-tailed macaque): 105498422 Help Entry 105498422         CDS       T08765                                  Symbol IFNA8 Name (RefSeq) interferon alpha-8   KO K05414   interferon alpha Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni04060   Cytokine-cytokine receptor interaction mni04151   PI3K-Akt signaling pathway mni04217   Necroptosis mni04620   Toll-like receptor signaling pathway mni04621   NOD-like receptor signaling pathway mni04622   RIG-I-like receptor signaling pathway mni04623   Cytosolic DNA-sensing pathway mni04630   JAK-STAT signaling pathway mni04650   Natural killer cell mediated cytotoxicity mni04936   Alcoholic liver disease mni05152   Tuberculosis mni05160   Hepatitis C mni05161   Hepatitis B mni05162   Measles mni05163   Human cytomegalovirus infection mni05164   Influenza A mni05165   Human papillomavirus infection mni05167   Kaposi sarcoma-associated herpesvirus infection mni05168   Herpes simplex virus 1 infection mni05169   Epstein-Barr virus infection mni05170   Human immunodeficiency virus 1 infection mni05171   Coronavirus disease - COVID-19 mni05200   Pathways in cancer mni05320   Autoimmune thyroid disease mni05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mni00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105498422 (IFNA8)    04151 PI3K-Akt signaling pathway     105498422 (IFNA8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105498422 (IFNA8)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105498422 (IFNA8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105498422 (IFNA8)    04621 NOD-like receptor signaling pathway     105498422 (IFNA8)    04622 RIG-I-like receptor signaling pathway     105498422 (IFNA8)    04623 Cytosolic DNA-sensing pathway     105498422 (IFNA8)    04650 Natural killer cell mediated cytotoxicity     105498422 (IFNA8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105498422 (IFNA8)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105498422 (IFNA8)    05161 Hepatitis B     105498422 (IFNA8)    05160 Hepatitis C     105498422 (IFNA8)    05171 Coronavirus disease - COVID-19     105498422 (IFNA8)    05164 Influenza A     105498422 (IFNA8)    05162 Measles     105498422 (IFNA8)    05168 Herpes simplex virus 1 infection     105498422 (IFNA8)    05163 Human cytomegalovirus infection     105498422 (IFNA8)    05167 Kaposi sarcoma-associated herpesvirus infection     105498422 (IFNA8)    05169 Epstein-Barr virus infection     105498422 (IFNA8)    05165 Human papillomavirus infection     105498422 (IFNA8)   09171 Infectious disease: bacterial    05152 Tuberculosis     105498422 (IFNA8)   09163 Immune disease    05320 Autoimmune thyroid disease     105498422 (IFNA8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105498422 (IFNA8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105498422 (IFNA8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mni04052]     105498422 (IFNA8) Cytokines and neuropeptides [BR:mni04052]  Cytokines   Interferons    105498422 (IFNA8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon CoV_NSP2_N DUF7516 Motif Other DBs NCBI-GeneID:  105498422 NCBI-ProteinID:  XP_011768794 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MALTFYLLMALVVLSYKPFSSLGCDLRETHSLGYRRPLVLLAQMRRISPFSCLKDRHDFE LPQEEFDDKNFQKAQAISVLHEIIQQTFNLFNTNNSSAAFNETLLDEFYIELDQQLNDLE SCVMQEVGVTETHLMYEDSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSFSLSIN LQKRLKSKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccttgaccttttatttactgatggccctagtggtgctcagctacaagccattcagc tctctgggctgtgatctgcgtgagacccacagcctgggttacaggaggcccttggtgctc ctggcacaaatgagaagaatctctcctttctcctgcctgaaggacagacatgactttgaa ttaccccaggaggagtttgatgacaaaaacttccagaaggctcaagccatctctgtcctc catgagataatccagcagaccttcaacctcttcaacacaaataattcatctgctgctttc aatgagacccttctagatgaattctacatcgaacttgaccagcagctgaatgacctggag tcctgtgtgatgcaggaagtgggggtgacagagactcacctgatgtacgaggactccatc ctggctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatacagc ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttatcaatcaac ttgcaaaaaagattgaagagtaaggaataa

DBGET integrated database retrieval system