Moraxella nasibovis: LU290_08735 Help Entry LU290_08735       CDS       T09322                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mnj  Moraxella nasibovis Pathway mnj01100   Metabolic pathways mnj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mnj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LU290_08735 (acpP)    00074 Mycolic acid biosynthesis     LU290_08735 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LU290_08735 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WFF38323 LinkDB All DBs Position complement(1845185..1845418) Genome browser AA seq 77 aa AA seqDB search MSDIEAKVKDAVAEQLGLNVADIKNDASFMDDLGADSLDLVELVMAFESNFGITIPDEDS AELTTVQKAIDYVTAKL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagctaaagtaaaagacgcagtggctgagcagcttggtctgaatgtt gctgacatcaagaatgacgcatcattcatggatgatttgggtgcagactcgctagaccta gtggagcttgtgatggcatttgaaagcaacttcggcatcaccattcctgatgaagattct gccgaattgaccacagttcaaaaagccattgactatgttactgcaaagctgtaa

DBGET integrated database retrieval system