Methylobacterium nodulans: Mnod_2747 Help Entry Mnod_2747         CDS       T00839                                  Name (GenBank) phosphopantetheine-binding   KO K02078   acyl carrier protein Organism mno  Methylobacterium nodulans Pathway mno00998   Biosynthesis of various antibiotics mno01100   Metabolic pathways mno01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mno00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Mnod_2747    00074 Mycolic acid biosynthesis     Mnod_2747   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Mnod_2747 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ACL57700 UniProt:  B8IFG5 LinkDB All DBs Position complement(2814747..2814992) Genome browser AA seq 81 aa AA seqDB search MSTVQDAVRAVIAETFGVPPERLSDDTVADDVDGWDSLSHTVLMIRLQNAFGIRIPESVA AEVATVGELVAAVADIAGMKR NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagcacggtacaggacgcggtccgggcggtcatcgccgaaaccttcggcgttccaccc gagcgtctctcggacgacaccgtcgcggacgacgtcgacggctgggattccctctcgcac acggtgctgatgatccgcctgcagaacgcctttggcatccgcatcccggagagcgtcgcg gccgaagtcgccacggtcggcgagctcgtcgcggccgtcgcggacatcgccgggatgaaa cgatag

DBGET integrated database retrieval system