Methylobacterium nodulans: Mnod_2785 Help Entry Mnod_2785         CDS       T00839                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mno  Methylobacterium nodulans Pathway mno00998   Biosynthesis of various antibiotics mno01100   Metabolic pathways mno01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mno00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Mnod_2785    00074 Mycolic acid biosynthesis     Mnod_2785   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Mnod_2785 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF1493 DUF5783 DNA_Packaging_2 Motif Other DBs NCBI-ProteinID:  ACL57737 UniProt:  B8IFK2 LinkDB All DBs Position complement(2866536..2866772) Genome browser AA seq 78 aa AA seqDB search MSDIADRVKKIVVEHLGVEAEKVTENANFIDDLGADSLDTVELVMAFEEEFNVEIPDDAA ETIQTVGDAIKFLEKNSG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcggaccgggtgaagaagatcgttgtcgagcacctcggcgtcgaagcc gagaaggtgaccgagaacgcgaacttcatcgacgatctcggggccgacagcctcgacacg gtcgagctggtgatggcgttcgaggaggagttcaacgtcgagatcccggatgacgcggcc gagaccatccagacggtcggcgacgcgatcaagttcctggagaagaactccggctga

DBGET integrated database retrieval system