Mustela nigripes (black-footed ferret): 131999888 Help Entry 131999888         CDS       T09425                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04024   cAMP signaling pathway mnp04062   Chemokine signaling pathway mnp04064   NF-kappa B signaling pathway mnp04210   Apoptosis mnp04380   Osteoclast differentiation mnp04620   Toll-like receptor signaling pathway mnp04621   NOD-like receptor signaling pathway mnp04622   RIG-I-like receptor signaling pathway mnp04623   Cytosolic DNA-sensing pathway mnp04625   C-type lectin receptor signaling pathway mnp04657   IL-17 signaling pathway mnp04658   Th1 and Th2 cell differentiation mnp04659   Th17 cell differentiation mnp04660   T cell receptor signaling pathway mnp04662   B cell receptor signaling pathway mnp04668   TNF signaling pathway mnp04722   Neurotrophin signaling pathway mnp04920   Adipocytokine signaling pathway mnp04926   Relaxin signaling pathway mnp04931   Insulin resistance mnp04936   Alcoholic liver disease mnp05132   Salmonella infection mnp05134   Legionellosis mnp05135   Yersinia infection mnp05140   Leishmaniasis mnp05142   Chagas disease mnp05145   Toxoplasmosis mnp05160   Hepatitis C mnp05161   Hepatitis B mnp05162   Measles mnp05163   Human cytomegalovirus infection mnp05164   Influenza A mnp05166   Human T-cell leukemia virus 1 infection mnp05167   Kaposi sarcoma-associated herpesvirus infection mnp05168   Herpes simplex virus 1 infection mnp05169   Epstein-Barr virus infection mnp05170   Human immunodeficiency virus 1 infection mnp05171   Coronavirus disease - COVID-19 mnp05200   Pathways in cancer mnp05203   Viral carcinogenesis mnp05208   Chemical carcinogenesis - reactive oxygen species mnp05215   Prostate cancer mnp05220   Chronic myeloid leukemia mnp05222   Small cell lung cancer mnp05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mnp05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     131999888 (NFKBIA)    04668 TNF signaling pathway     131999888 (NFKBIA)    04024 cAMP signaling pathway     131999888 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     131999888 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     131999888 (NFKBIA)    04621 NOD-like receptor signaling pathway     131999888 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     131999888 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     131999888 (NFKBIA)    04625 C-type lectin receptor signaling pathway     131999888 (NFKBIA)    04660 T cell receptor signaling pathway     131999888 (NFKBIA)    04658 Th1 and Th2 cell differentiation     131999888 (NFKBIA)    04659 Th17 cell differentiation     131999888 (NFKBIA)    04657 IL-17 signaling pathway     131999888 (NFKBIA)    04662 B cell receptor signaling pathway     131999888 (NFKBIA)    04062 Chemokine signaling pathway     131999888 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     131999888 (NFKBIA)    04926 Relaxin signaling pathway     131999888 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     131999888 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     131999888 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     131999888 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     131999888 (NFKBIA)    05203 Viral carcinogenesis     131999888 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     131999888 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     131999888 (NFKBIA)    05215 Prostate cancer     131999888 (NFKBIA)    05222 Small cell lung cancer     131999888 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     131999888 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     131999888 (NFKBIA)    05161 Hepatitis B     131999888 (NFKBIA)    05160 Hepatitis C     131999888 (NFKBIA)    05171 Coronavirus disease - COVID-19     131999888 (NFKBIA)    05164 Influenza A     131999888 (NFKBIA)    05162 Measles     131999888 (NFKBIA)    05168 Herpes simplex virus 1 infection     131999888 (NFKBIA)    05163 Human cytomegalovirus infection     131999888 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     131999888 (NFKBIA)    05169 Epstein-Barr virus infection     131999888 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     131999888 (NFKBIA)    05135 Yersinia infection     131999888 (NFKBIA)    05134 Legionellosis     131999888 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     131999888 (NFKBIA)    05140 Leishmaniasis     131999888 (NFKBIA)    05142 Chagas disease     131999888 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     131999888 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     131999888 (NFKBIA)    04931 Insulin resistance     131999888 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mnp03000]     131999888 (NFKBIA)    04131 Membrane trafficking [BR:mnp04131]     131999888 (NFKBIA) Transcription factors [BR:mnp03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     131999888 (NFKBIA) Membrane trafficking [BR:mnp04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     131999888 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 Motif Other DBs NCBI-GeneID:  131999888 NCBI-ProteinID:  XP_059229066 LinkDB All DBs Position 13:complement(83777325..83780637) Genome browser AA seq 314 aa AA seqDB search MFQAAEHNQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQLVKELKEIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCRTQHLSSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNSDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgtttcaggccgccgagcacaaccaggactgggccatggagggtccccgggacgcgctc aagaaggagcgcctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagttggtgaaggaactgaaggagatccgcctcgagccgcaggaggcgccg cgcggcgccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggcactgaccatggaagtgatccgccaagtgaagggcgac ctggcctttctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc accaaccaaccagaaattgctgaggcacttctgggagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcaaggctgcctggccagtgtg ggagtcctgactcagacctgcaggacccagcacctctcctccatcctccaggccactaac tacaatgggcacacatgtctccatttagcctctatccatggttacttgggcattgtggaa cttctggtgtctctgggtgctgacgtcaatgctcaggagccctgcaatggccgaaccgcc ctccatctcgccgtggacctccagaattctgatctcgtgtcactcttgttgaagtgtggg gctgatgtcaacagagttacctaccagggctattccccataccagctcacctggggccgc ccaagcacgcggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctg ccagagagcgaggatgaggagagctacgacacagagtccgagttcacggaggacgagctg ccctatgatgactgtgtgcttggaggccagcgcctgacgttatga

DBGET integrated database retrieval system