Mustela nigripes (black-footed ferret): 132001334 Help Entry 132001334         CDS       T09425                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp01521   EGFR tyrosine kinase inhibitor resistance mnp01522   Endocrine resistance mnp04010   MAPK signaling pathway mnp04012   ErbB signaling pathway mnp04014   Ras signaling pathway mnp04015   Rap1 signaling pathway mnp04062   Chemokine signaling pathway mnp04068   FoxO signaling pathway mnp04071   Sphingolipid signaling pathway mnp04072   Phospholipase D signaling pathway mnp04137   Mitophagy - animal mnp04140   Autophagy - animal mnp04150   mTOR signaling pathway mnp04151   PI3K-Akt signaling pathway mnp04210   Apoptosis mnp04211   Longevity regulating pathway mnp04213   Longevity regulating pathway - multiple species mnp04218   Cellular senescence mnp04360   Axon guidance mnp04370   VEGF signaling pathway mnp04371   Apelin signaling pathway mnp04540   Gap junction mnp04550   Signaling pathways regulating pluripotency of stem cells mnp04625   C-type lectin receptor signaling pathway mnp04650   Natural killer cell mediated cytotoxicity mnp04660   T cell receptor signaling pathway mnp04662   B cell receptor signaling pathway mnp04664   Fc epsilon RI signaling pathway mnp04714   Thermogenesis mnp04720   Long-term potentiation mnp04722   Neurotrophin signaling pathway mnp04725   Cholinergic synapse mnp04726   Serotonergic synapse mnp04730   Long-term depression mnp04810   Regulation of actin cytoskeleton mnp04910   Insulin signaling pathway mnp04912   GnRH signaling pathway mnp04915   Estrogen signaling pathway mnp04916   Melanogenesis mnp04917   Prolactin signaling pathway mnp04919   Thyroid hormone signaling pathway mnp04921   Oxytocin signaling pathway mnp04926   Relaxin signaling pathway mnp04929   GnRH secretion mnp04933   AGE-RAGE signaling pathway in diabetic complications mnp04935   Growth hormone synthesis, secretion and action mnp05010   Alzheimer disease mnp05022   Pathways of neurodegeneration - multiple diseases mnp05034   Alcoholism mnp05160   Hepatitis C mnp05161   Hepatitis B mnp05163   Human cytomegalovirus infection mnp05165   Human papillomavirus infection mnp05166   Human T-cell leukemia virus 1 infection mnp05167   Kaposi sarcoma-associated herpesvirus infection mnp05170   Human immunodeficiency virus 1 infection mnp05200   Pathways in cancer mnp05203   Viral carcinogenesis mnp05205   Proteoglycans in cancer mnp05206   MicroRNAs in cancer mnp05207   Chemical carcinogenesis - receptor activation mnp05208   Chemical carcinogenesis - reactive oxygen species mnp05210   Colorectal cancer mnp05211   Renal cell carcinoma mnp05213   Endometrial cancer mnp05214   Glioma mnp05215   Prostate cancer mnp05216   Thyroid cancer mnp05218   Melanoma mnp05219   Bladder cancer mnp05220   Chronic myeloid leukemia mnp05221   Acute myeloid leukemia mnp05223   Non-small cell lung cancer mnp05224   Breast cancer mnp05225   Hepatocellular carcinoma mnp05226   Gastric cancer mnp05230   Central carbon metabolism in cancer mnp05231   Choline metabolism in cancer mnp05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mnp05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     132001334 (NRAS)    04012 ErbB signaling pathway     132001334 (NRAS)    04014 Ras signaling pathway     132001334 (NRAS)    04015 Rap1 signaling pathway     132001334 (NRAS)    04370 VEGF signaling pathway     132001334 (NRAS)    04371 Apelin signaling pathway     132001334 (NRAS)    04068 FoxO signaling pathway     132001334 (NRAS)    04072 Phospholipase D signaling pathway     132001334 (NRAS)    04071 Sphingolipid signaling pathway     132001334 (NRAS)    04151 PI3K-Akt signaling pathway     132001334 (NRAS)    04150 mTOR signaling pathway     132001334 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     132001334 (NRAS)    04137 Mitophagy - animal     132001334 (NRAS)   09143 Cell growth and death    04210 Apoptosis     132001334 (NRAS)    04218 Cellular senescence     132001334 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     132001334 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     132001334 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     132001334 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     132001334 (NRAS)    04650 Natural killer cell mediated cytotoxicity     132001334 (NRAS)    04660 T cell receptor signaling pathway     132001334 (NRAS)    04662 B cell receptor signaling pathway     132001334 (NRAS)    04664 Fc epsilon RI signaling pathway     132001334 (NRAS)    04062 Chemokine signaling pathway     132001334 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     132001334 (NRAS)    04929 GnRH secretion     132001334 (NRAS)    04912 GnRH signaling pathway     132001334 (NRAS)    04915 Estrogen signaling pathway     132001334 (NRAS)    04917 Prolactin signaling pathway     132001334 (NRAS)    04921 Oxytocin signaling pathway     132001334 (NRAS)    04926 Relaxin signaling pathway     132001334 (NRAS)    04935 Growth hormone synthesis, secretion and action     132001334 (NRAS)    04919 Thyroid hormone signaling pathway     132001334 (NRAS)    04916 Melanogenesis     132001334 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     132001334 (NRAS)    04726 Serotonergic synapse     132001334 (NRAS)    04720 Long-term potentiation     132001334 (NRAS)    04730 Long-term depression     132001334 (NRAS)    04722 Neurotrophin signaling pathway     132001334 (NRAS)   09158 Development and regeneration    04360 Axon guidance     132001334 (NRAS)   09149 Aging    04211 Longevity regulating pathway     132001334 (NRAS)    04213 Longevity regulating pathway - multiple species     132001334 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     132001334 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     132001334 (NRAS)    05206 MicroRNAs in cancer     132001334 (NRAS)    05205 Proteoglycans in cancer     132001334 (NRAS)    05207 Chemical carcinogenesis - receptor activation     132001334 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     132001334 (NRAS)    05203 Viral carcinogenesis     132001334 (NRAS)    05230 Central carbon metabolism in cancer     132001334 (NRAS)    05231 Choline metabolism in cancer     132001334 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     132001334 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     132001334 (NRAS)    05225 Hepatocellular carcinoma     132001334 (NRAS)    05226 Gastric cancer     132001334 (NRAS)    05214 Glioma     132001334 (NRAS)    05216 Thyroid cancer     132001334 (NRAS)    05221 Acute myeloid leukemia     132001334 (NRAS)    05220 Chronic myeloid leukemia     132001334 (NRAS)    05218 Melanoma     132001334 (NRAS)    05211 Renal cell carcinoma     132001334 (NRAS)    05219 Bladder cancer     132001334 (NRAS)    05215 Prostate cancer     132001334 (NRAS)    05213 Endometrial cancer     132001334 (NRAS)    05224 Breast cancer     132001334 (NRAS)    05223 Non-small cell lung cancer     132001334 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     132001334 (NRAS)    05170 Human immunodeficiency virus 1 infection     132001334 (NRAS)    05161 Hepatitis B     132001334 (NRAS)    05160 Hepatitis C     132001334 (NRAS)    05163 Human cytomegalovirus infection     132001334 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     132001334 (NRAS)    05165 Human papillomavirus infection     132001334 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     132001334 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     132001334 (NRAS)   09165 Substance dependence    05034 Alcoholism     132001334 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     132001334 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     132001334 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     132001334 (NRAS)    01522 Endocrine resistance     132001334 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mnp04131]     132001334 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mnp04147]     132001334 (NRAS)    04031 GTP-binding proteins [BR:mnp04031]     132001334 (NRAS) Membrane trafficking [BR:mnp04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     132001334 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     132001334 (NRAS) Exosome [BR:mnp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    132001334 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    132001334 (NRAS)   Exosomal proteins of breast cancer cells    132001334 (NRAS)   Exosomal proteins of colorectal cancer cells    132001334 (NRAS) GTP-binding proteins [BR:mnp04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     132001334 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  132001334 NCBI-ProteinID:  XP_059231794 LinkDB All DBs Position 14:complement(98338506..98348699) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagatggtgaaacctgtttgttggacatactggatacagctggt caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggagcagatt aagcgagtaaaagattcagatgatgtacctatggtgctagtaggaaataagtgtgatttg ccaacaaggacagtggacacaaaacaagcccacgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgtcgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaagaaactcaatagcagtgatgatggaactcaaggt tgtatggggttaccttgtgtggtgatgtaa

DBGET integrated database retrieval system