Mustela nigripes (black-footed ferret): 132001491 Help Entry 132001491         CDS       T09425                                  Symbol S100A10 Name (RefSeq) protein S100-A10 isoform X1   KO K17274   protein S100-A10 Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04382   Cornified envelope formation mnp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mnp00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     132001491 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     132001491 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mnp04147]     132001491 (S100A10) Exosome [BR:mnp04147]  Exosomal proteins   Exosomal proteins of microglial cells    132001491 (S100A10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 TMP_3 Motif Other DBs NCBI-GeneID:  132001491 NCBI-ProteinID:  XP_059232162 LinkDB All DBs Position 14:complement(106982127..106993196) Genome browser AA seq 109 aa AA seqDB search MLSGEVSTDLTKMPSQMEHAMETMMFTFHKFAGEKGYLTKEDLRVLMEKEFPGFLENQKD PLVVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNNYFVVHMKQKGKK NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgctctcaggcgaggtttcaacagacctcaccaaaatgccatctcaaatggaacatgcc atggaaaccatgatgttcacatttcacaagtttgctggtgaaaaaggctacttaacaaag gaggacctgcgagtactcatggaaaaggagttccctggatttttggaaaatcagaaagac cctctggtcgtggacaaaataatgaaggacctcgaccagtgccgagatggcaaagtgggc ttccagagcttcttctcgctaatcgcagggctcaccattgcatgcaataactattttgta gtacacatgaagcagaagggaaagaaatag

DBGET integrated database retrieval system