Mustela nigripes (black-footed ferret): 132002170 Help Entry 132002170         CDS       T09425                                  Symbol CALML6 Name (RefSeq) calmodulin-like protein 6   KO K02183   calmodulin Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04014   Ras signaling pathway mnp04015   Rap1 signaling pathway mnp04020   Calcium signaling pathway mnp04022   cGMP-PKG signaling pathway mnp04024   cAMP signaling pathway mnp04070   Phosphatidylinositol signaling system mnp04114   Oocyte meiosis mnp04218   Cellular senescence mnp04261   Adrenergic signaling in cardiomyocytes mnp04270   Vascular smooth muscle contraction mnp04371   Apelin signaling pathway mnp04625   C-type lectin receptor signaling pathway mnp04713   Circadian entrainment mnp04720   Long-term potentiation mnp04722   Neurotrophin signaling pathway mnp04728   Dopaminergic synapse mnp04740   Olfactory transduction mnp04744   Phototransduction mnp04750   Inflammatory mediator regulation of TRP channels mnp04910   Insulin signaling pathway mnp04912   GnRH signaling pathway mnp04915   Estrogen signaling pathway mnp04916   Melanogenesis mnp04921   Oxytocin signaling pathway mnp04922   Glucagon signaling pathway mnp04924   Renin secretion mnp04925   Aldosterone synthesis and secretion mnp04970   Salivary secretion mnp04971   Gastric acid secretion mnp05010   Alzheimer disease mnp05012   Parkinson disease mnp05022   Pathways of neurodegeneration - multiple diseases mnp05031   Amphetamine addiction mnp05034   Alcoholism mnp05133   Pertussis mnp05152   Tuberculosis mnp05163   Human cytomegalovirus infection mnp05167   Kaposi sarcoma-associated herpesvirus infection mnp05170   Human immunodeficiency virus 1 infection mnp05200   Pathways in cancer mnp05214   Glioma mnp05417   Lipid and atherosclerosis mnp05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     132002170 (CALML6)    04015 Rap1 signaling pathway     132002170 (CALML6)    04371 Apelin signaling pathway     132002170 (CALML6)    04020 Calcium signaling pathway     132002170 (CALML6)    04070 Phosphatidylinositol signaling system     132002170 (CALML6)    04024 cAMP signaling pathway     132002170 (CALML6)    04022 cGMP-PKG signaling pathway     132002170 (CALML6)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     132002170 (CALML6)    04218 Cellular senescence     132002170 (CALML6)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     132002170 (CALML6)   09152 Endocrine system    04910 Insulin signaling pathway     132002170 (CALML6)    04922 Glucagon signaling pathway     132002170 (CALML6)    04912 GnRH signaling pathway     132002170 (CALML6)    04915 Estrogen signaling pathway     132002170 (CALML6)    04921 Oxytocin signaling pathway     132002170 (CALML6)    04916 Melanogenesis     132002170 (CALML6)    04924 Renin secretion     132002170 (CALML6)    04925 Aldosterone synthesis and secretion     132002170 (CALML6)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     132002170 (CALML6)    04270 Vascular smooth muscle contraction     132002170 (CALML6)   09154 Digestive system    04970 Salivary secretion     132002170 (CALML6)    04971 Gastric acid secretion     132002170 (CALML6)   09156 Nervous system    04728 Dopaminergic synapse     132002170 (CALML6)    04720 Long-term potentiation     132002170 (CALML6)    04722 Neurotrophin signaling pathway     132002170 (CALML6)   09157 Sensory system    04744 Phototransduction     132002170 (CALML6)    04740 Olfactory transduction     132002170 (CALML6)    04750 Inflammatory mediator regulation of TRP channels     132002170 (CALML6)   09159 Environmental adaptation    04713 Circadian entrainment     132002170 (CALML6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     132002170 (CALML6)   09162 Cancer: specific types    05214 Glioma     132002170 (CALML6)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     132002170 (CALML6)    05163 Human cytomegalovirus infection     132002170 (CALML6)    05167 Kaposi sarcoma-associated herpesvirus infection     132002170 (CALML6)   09171 Infectious disease: bacterial    05133 Pertussis     132002170 (CALML6)    05152 Tuberculosis     132002170 (CALML6)   09164 Neurodegenerative disease    05010 Alzheimer disease     132002170 (CALML6)    05012 Parkinson disease     132002170 (CALML6)    05022 Pathways of neurodegeneration - multiple diseases     132002170 (CALML6)   09165 Substance dependence    05031 Amphetamine addiction     132002170 (CALML6)    05034 Alcoholism     132002170 (CALML6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     132002170 (CALML6)    05418 Fluid shear stress and atherosclerosis     132002170 (CALML6)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mnp01009]     132002170 (CALML6)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mnp04131]     132002170 (CALML6)    03036 Chromosome and associated proteins [BR:mnp03036]     132002170 (CALML6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mnp04147]     132002170 (CALML6) Protein phosphatases and associated proteins [BR:mnp01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      132002170 (CALML6) Membrane trafficking [BR:mnp04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     132002170 (CALML6) Chromosome and associated proteins [BR:mnp03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      132002170 (CALML6) Exosome [BR:mnp04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    132002170 (CALML6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 AIF-1 EF-hand_9 EF-hand_5 EH EF_EFCAB10_C EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  132002170 NCBI-ProteinID:  XP_059233188 LinkDB All DBs Position 14:749053..750271 Genome browser AA seq 223 aa AA seqDB search QSAVHPWRASPVPPCLEARWAAGEGAPSLSPTVQGCRVEGQGGVPRVLGPPPPSDRGAEA ALVQVSLQTERLTAEQIKEYKGVFEMFDEEGNGQVKTAELERLMSLLGINPTKSELASMA QDVDRDNKGFFNCDSFLALMGIYWEKAQNQEGELRAAFRVFDKDGKGYIDWNTLKYVLMN AGEPLNEAEAEQMMKEADKDGDGTIDYEEFVAMMTGESFKLVQ NT seq 672 nt NT seq  +upstreamnt  +downstreamnt cagagtgccgttcacccctggcgagcctccccagtgccaccttgtctggaagcgcgctgg gctgcgggggagggggctccttctttatccccaaccgtgcagggctgccgggtggaggga cagggcggggtgccacgcgtgctaggaccgccacctccctcggaccgaggggcggaggcg gccctggtgcaggtgtccttgcagacggagcgcctgacagcggagcagatcaaggagtac aagggcgtcttcgagatgttcgacgaggagggcaacgggcaggtgaagaccgccgagctg gagcggctcatgagcctgctgggcatcaaccccaccaagagtgagctggcctccatggcc caggacgtggacagagacaacaaaggattcttcaactgtgacagcttcctggccctgatg gggatctactgggagaaggcccagaaccaggagggcgagctgcgggccgcgttccgcgtc ttcgacaaggacggcaagggctacatcgactggaacacgctcaagtacgtgctcatgaac gcgggggagcccctcaacgaggcggaggccgagcagatgatgaaggaggccgacaaggac ggggacgggaccattgactacgaggagtttgtggccatgatgaccggagagtccttcaag ctggtccagtga

DBGET integrated database retrieval system