Mustela nigripes (black-footed ferret): 132003134 Help Entry 132003134         CDS       T09425                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04081   Hormone signaling mnp04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     132003134 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     132003134 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mnp04052]     132003134 (GAST) Cytokines and neuropeptides [BR:mnp04052]  Neuropeptides   GPCR binding    132003134 (GAST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  132003134 NCBI-ProteinID:  XP_059234419 LinkDB All DBs Position 16:complement(20216120..20216564) Genome browser AA seq 104 aa AA seqDB search MQRLCVCVLILALALATFSEAAWKPGSQQQDAPSGPGANRGLEPHWLDRLGAAPHQRRQL GLQGPPQLVADLSKKQGPWVEEEEAAYGWMDFGRRSAEEGDQRP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcgactgtgtgtgtgtgtgctgatcctggcgctggctctggccaccttctctgaa gctgcttggaagcccggctcccagcagcaggacgcaccctcaggtccaggggcaaataga ggcctggagccacactggctggaccggctgggcgctgcccctcaccagcgaaggcagctg gggctccaaggtcccccacagctggtggcagacctgtccaagaagcagggaccgtgggtg gaggaagaagaagcagcatacggatggatggactttggccgccgcagtgctgaggaaggg gaccagcgtccctag

DBGET integrated database retrieval system