Mustela nigripes (black-footed ferret): 132003142 Help Entry 132003142         CDS       T09425                                  Name (RefSeq) C-C motif chemokine 3   KO K05408   C-C motif chemokine 3 Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04060   Cytokine-cytokine receptor interaction mnp04061   Viral protein interaction with cytokine and cytokine receptor mnp04062   Chemokine signaling pathway mnp04620   Toll-like receptor signaling pathway mnp05142   Chagas disease mnp05163   Human cytomegalovirus infection mnp05323   Rheumatoid arthritis mnp05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     132003142    04061 Viral protein interaction with cytokine and cytokine receptor     132003142  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     132003142    04062 Chemokine signaling pathway     132003142  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     132003142   09174 Infectious disease: parasitic    05142 Chagas disease     132003142   09163 Immune disease    05323 Rheumatoid arthritis     132003142   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     132003142  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mnp04052]     132003142    00536 Glycosaminoglycan binding proteins [BR:mnp00536]     132003142 Cytokines and neuropeptides [BR:mnp04052]  Cytokines   Chemokines    132003142 Glycosaminoglycan binding proteins [BR:mnp00536]  Heparan sulfate / Heparin   Chemokines    132003142 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  132003142 NCBI-ProteinID:  XP_059234437 LinkDB All DBs Position 16:36787792..36789701 Genome browser AA seq 93 aa AA seqDB search MKVPGAALAVLLCIMALCSQVFSAPFGADTPTACCFSYVSKQITRKFIVDYFETSSQCSK PGVIFQTRKGRQLCADPTEDWVQEYVTDLELNA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaggttcccggggctgccctcgccgtcctcctctgcatcatggccctctgcagccag gtcttctctgcaccatttggtgcggacaccccaaccgcctgctgcttctcctacgtctcc aagcagattacacgcaagttcatagtcgactattttgagaccagcagccaatgctccaag cctggtgttattttccagaccagaaaaggccgccagctctgtgccgaccccactgaggac tgggtccaggagtacgtgaccgacctggagctgaatgcctga

DBGET integrated database retrieval system