Mustela nigripes (black-footed ferret): 132003436 Help Entry 132003436         CDS       T09425                                  Name (RefSeq) C-C motif chemokine 2   KO K14624   C-C motif chemokine 2 Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04060   Cytokine-cytokine receptor interaction mnp04061   Viral protein interaction with cytokine and cytokine receptor mnp04062   Chemokine signaling pathway mnp04621   NOD-like receptor signaling pathway mnp04657   IL-17 signaling pathway mnp04668   TNF signaling pathway mnp04933   AGE-RAGE signaling pathway in diabetic complications mnp05135   Yersinia infection mnp05142   Chagas disease mnp05144   Malaria mnp05163   Human cytomegalovirus infection mnp05164   Influenza A mnp05168   Herpes simplex virus 1 infection mnp05171   Coronavirus disease - COVID-19 mnp05323   Rheumatoid arthritis mnp05417   Lipid and atherosclerosis mnp05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     132003436   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     132003436    04061 Viral protein interaction with cytokine and cytokine receptor     132003436  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     132003436    04657 IL-17 signaling pathway     132003436    04062 Chemokine signaling pathway     132003436  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     132003436    05164 Influenza A     132003436    05168 Herpes simplex virus 1 infection     132003436    05163 Human cytomegalovirus infection     132003436   09171 Infectious disease: bacterial    05135 Yersinia infection     132003436   09174 Infectious disease: parasitic    05144 Malaria     132003436    05142 Chagas disease     132003436   09163 Immune disease    05323 Rheumatoid arthritis     132003436   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     132003436    05418 Fluid shear stress and atherosclerosis     132003436   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     132003436  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mnp04052]     132003436    00536 Glycosaminoglycan binding proteins [BR:mnp00536]     132003436 Cytokines and neuropeptides [BR:mnp04052]  Cytokines   Chemokines    132003436 Glycosaminoglycan binding proteins [BR:mnp00536]  Heparan sulfate / Heparin   Chemokines    132003436 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  132003436 NCBI-ProteinID:  XP_059234885 LinkDB All DBs Position 16:complement(38041493..38043214) Genome browser AA seq 101 aa AA seqDB search MKVSATLLCLLLTAAAISIQVLAQPDAINSPVTCCYTFTNKKISVQRLVSYKRVTSSKCP KEAVILKTFLNKEICADPSQKWVRDSMAHLDKKTQTQTAKP NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctctgccacacttctctgcctgctgctcacggctgccgccatcagtatccag gtgctcgcccagccagatgcaattaattctccggtcacctgctgctatacattcaccaat aagaagatctcagtgcagaggctggtgagctataagagagtcaccagcagcaagtgtccc aaagaagctgtgatcctcaagacattccttaacaaggagatctgcgctgaccccagtcag aagtgggtccgggattccatggcacacctggacaagaaaacccagacccaaactgcaaag ccatga

DBGET integrated database retrieval system