Mustela nigripes (black-footed ferret): 132004806 Help Entry 132004806         CDS       T09425                                  Symbol CCL22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04060   Cytokine-cytokine receptor interaction mnp04061   Viral protein interaction with cytokine and cytokine receptor mnp04062   Chemokine signaling pathway mnp04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     132004806 (CCL22)    04061 Viral protein interaction with cytokine and cytokine receptor     132004806 (CCL22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     132004806 (CCL22)    04062 Chemokine signaling pathway     132004806 (CCL22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mnp04052]     132004806 (CCL22) Cytokines and neuropeptides [BR:mnp04052]  Cytokines   Chemokines    132004806 (CCL22) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  132004806 NCBI-ProteinID:  XP_059237326 LinkDB All DBs Position 17:33321428..33327665 Genome browser AA seq 93 aa AA seqDB search MASLNTPLLAALVFLALILQTTEAGPYGTNVEDSVCCREYFRHPLPLRMIRFFYWTSDSC RRPGVVFLTVKDREICADPRMPWVKKILQKLSA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggccagcctgaacactccactcctggctgcccttgtctttcttgctctgatacttcaa acaactgaggcaggtccttatggcaccaacgtggaagacagcgtctgctgccgggagtac ttccgtcaccctctgcctctgcgcatgatcaggtttttctactggacttcagactcgtgc cggaggcctggcgtggtcttcctaactgtcaaggaccgggagatctgtgctgaccccaga atgccctgggtgaaaaagattctccagaaactgagcgcatga

DBGET integrated database retrieval system