Mustela nigripes (black-footed ferret): 132005252 Help Entry 132005252         CDS       T09425                                  Symbol FGF21 Name (RefSeq) fibroblast growth factor 21   KO K22429   fibroblast growth factor 21 Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04010   MAPK signaling pathway mnp04014   Ras signaling pathway mnp04015   Rap1 signaling pathway mnp04020   Calcium signaling pathway mnp04151   PI3K-Akt signaling pathway mnp04714   Thermogenesis mnp04810   Regulation of actin cytoskeleton mnp05200   Pathways in cancer mnp05218   Melanoma mnp05224   Breast cancer mnp05226   Gastric cancer Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     132005252 (FGF21)    04014 Ras signaling pathway     132005252 (FGF21)    04015 Rap1 signaling pathway     132005252 (FGF21)    04020 Calcium signaling pathway     132005252 (FGF21)    04151 PI3K-Akt signaling pathway     132005252 (FGF21)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     132005252 (FGF21)  09150 Organismal Systems   09159 Environmental adaptation    04714 Thermogenesis     132005252 (FGF21)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     132005252 (FGF21)   09162 Cancer: specific types    05226 Gastric cancer     132005252 (FGF21)    05218 Melanoma     132005252 (FGF21)    05224 Breast cancer     132005252 (FGF21)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mnp04052]     132005252 (FGF21)    00536 Glycosaminoglycan binding proteins [BR:mnp00536]     132005252 (FGF21) Cytokines and neuropeptides [BR:mnp04052]  Cytokines   Growth factors (RTK binding)    132005252 (FGF21) Glycosaminoglycan binding proteins [BR:mnp00536]  Heparan sulfate / Heparin   Growth factors/receptors    132005252 (FGF21) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Birna_VP1_thumb Motif Other DBs NCBI-GeneID:  132005252 NCBI-ProteinID:  XP_059238141 LinkDB All DBs Position 17:complement(5814181..5817918) Genome browser AA seq 209 aa AA seqDB search MGWEEARSEHLGLWVPVLAVLLLGACQAYPIPDSSPLLQFGGQVRQRYLYTDDAQETEAH LEIRADGTVVGAARRSPESLLELKALKPGVIQILGVKTSRFLCQGPNGTLYGSFHFDPVA CSFREVLLEDGYNIYHSETLGLPLRLPPHNSPYRDLAPRGPARFLPLPGLLPATPESRGI PAPEPPDVGSSDPLSMVGPLQGQSPSYTS NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atgggctgggaagaggccaggtccgagcacctggggctgtgggtccctgtgctggcagtc cttttgctgggagcctgccaggcataccctattcctgactccagccccctcctccaattt ggaggccaagttcgacagcggtacctctacacagacgacgctcaggagacggaggcccac ctagagatcagggctgatggcacggtggtgggggctgcccgccggagccccgaaagtctc ttggagctgaaagccctgaagccaggggtcattcagatcttgggagtgaaaacatccagg ttcctgtgccagggcccgaatgggacactgtacggatcgttccacttcgaccccgtagcc tgcagcttccgggaagtgcttctggaagatggatacaacatctaccactctgagaccctg ggcctcccactgcgcctgcccccccacaactccccataccgggacctggcgccccggggg cctgcccgcttcctgcccctgccaggcctgcttccggccaccccggagtcccgggggatc ccagcccccgagcctcccgacgtgggctcctcagaccccctgagcatggtggggcctttg cagggtcaaagtcccagctacacttcctga

DBGET integrated database retrieval system