Mustela nigripes (black-footed ferret): 132007759 Help Entry 132007759         CDS       T09425                                  Symbol APLN Name (RefSeq) apelin   KO K05225   apelin Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04080   Neuroactive ligand-receptor interaction mnp04371   Apelin signaling pathway Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     132007759 (APLN)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     132007759 (APLN)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mnp04052]     132007759 (APLN) Cytokines and neuropeptides [BR:mnp04052]  Neuropeptides   GPCR binding    132007759 (APLN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Apelin Motif Other DBs NCBI-GeneID:  132007759 NCBI-ProteinID:  XP_059242079 LinkDB All DBs Position X:20584113..20592133 Genome browser AA seq 77 aa AA seqDB search MNLRRCVQALLLLWLSLTAACGGPLPQPADGKGLEEGSVRHLVQPRGSRNGPGPWQGGRR KFRRQRPRLSHKGPMPF NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaatctgcggcgctgcgtgcaggcgctcctgctgctctggctctccctgactgcggcg tgtggagggcccctgccgcagcctgctgatggcaaggggctggaggagggcagcgtccgc cacctggtgcagcccagaggctcgaggaatggaccggggccctggcagggcggtcggagg aaatttcgccgccagcggccacgcctctcccacaagggccccatgcctttctga

DBGET integrated database retrieval system