Mustela nigripes (black-footed ferret): 132008962 Help Entry 132008962         CDS       T09425                                  Name (RefSeq) interferon alpha-1/2-like   KO K05414   interferon alpha Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04060   Cytokine-cytokine receptor interaction mnp04151   PI3K-Akt signaling pathway mnp04217   Necroptosis mnp04620   Toll-like receptor signaling pathway mnp04621   NOD-like receptor signaling pathway mnp04622   RIG-I-like receptor signaling pathway mnp04623   Cytosolic DNA-sensing pathway mnp04630   JAK-STAT signaling pathway mnp04650   Natural killer cell mediated cytotoxicity mnp04936   Alcoholic liver disease mnp05152   Tuberculosis mnp05160   Hepatitis C mnp05161   Hepatitis B mnp05162   Measles mnp05163   Human cytomegalovirus infection mnp05164   Influenza A mnp05165   Human papillomavirus infection mnp05167   Kaposi sarcoma-associated herpesvirus infection mnp05168   Herpes simplex virus 1 infection mnp05169   Epstein-Barr virus infection mnp05170   Human immunodeficiency virus 1 infection mnp05171   Coronavirus disease - COVID-19 mnp05200   Pathways in cancer mnp05320   Autoimmune thyroid disease mnp05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     132008962    04151 PI3K-Akt signaling pathway     132008962   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     132008962  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     132008962  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     132008962    04621 NOD-like receptor signaling pathway     132008962    04622 RIG-I-like receptor signaling pathway     132008962    04623 Cytosolic DNA-sensing pathway     132008962    04650 Natural killer cell mediated cytotoxicity     132008962  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     132008962   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     132008962    05161 Hepatitis B     132008962    05160 Hepatitis C     132008962    05171 Coronavirus disease - COVID-19     132008962    05164 Influenza A     132008962    05162 Measles     132008962    05168 Herpes simplex virus 1 infection     132008962    05163 Human cytomegalovirus infection     132008962    05167 Kaposi sarcoma-associated herpesvirus infection     132008962    05169 Epstein-Barr virus infection     132008962    05165 Human papillomavirus infection     132008962   09171 Infectious disease: bacterial    05152 Tuberculosis     132008962   09163 Immune disease    05320 Autoimmune thyroid disease     132008962   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     132008962   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     132008962  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mnp04052]     132008962 Cytokines and neuropeptides [BR:mnp04052]  Cytokines   Interferons    132008962 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  132008962 NCBI-ProteinID:  XP_059243405 LinkDB All DBs Position Unknown AA seq 198 aa AA seqDB search MALSCSFLVALLVLSCHSLGSLGCDLPQNHGLLQWRALMLLRQMRRLSASSCDNYTNHFG FPQEEFDSKALQKSHALSVVHVMNQKTFHLFCTEASPAPWNTTLLEELCSGLSEQLDRLA ACPLLEVGVGELPLVNRDSILRNYFQRISLYLQEKQYSPCAWEMVRAEIMKPLYASIALH KRLRSGKSHPFQHGNDSF NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atggccctatcctgttccttcttggtggccctgttggtgctcagctgccactcccttggc tctctgggatgtgacctgcctcagaaccacggcctgctgcagtggagggccctgatgctc ctgcgacaaatgaggagactgtctgctagctcctgtgacaactacacaaaccactttggc ttcccacaggaggagtttgacagcaaggcgctacagaagtctcacgccctctctgttgtc catgtgatgaaccagaagaccttccacctcttctgcacagaggcctcacctgctccttgg aacacgaccctcctggaggaattgtgctcaggactttctgagcagctggatcgcctggca gcctgtcctctgctggaggtgggggtaggagagctgcccctggtgaacagggactccatc ctgaggaactacttccagagaatctccctctatctgcaagagaagcaatacagcccttgt gcctgggagatggtccgagcagagatcatgaaacccttgtatgcatcaatagccttacat aagagactaaggagcgggaagtcacacccctttcaacatggaaatgattccttctga

DBGET integrated database retrieval system