Mustela nigripes (black-footed ferret): 132009205 Help Entry 132009205         CDS       T09425                                  Name (RefSeq) interferon alpha-1/2-like   KO K05414   interferon alpha Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04060   Cytokine-cytokine receptor interaction mnp04151   PI3K-Akt signaling pathway mnp04217   Necroptosis mnp04620   Toll-like receptor signaling pathway mnp04621   NOD-like receptor signaling pathway mnp04622   RIG-I-like receptor signaling pathway mnp04623   Cytosolic DNA-sensing pathway mnp04630   JAK-STAT signaling pathway mnp04650   Natural killer cell mediated cytotoxicity mnp04936   Alcoholic liver disease mnp05152   Tuberculosis mnp05160   Hepatitis C mnp05161   Hepatitis B mnp05162   Measles mnp05163   Human cytomegalovirus infection mnp05164   Influenza A mnp05165   Human papillomavirus infection mnp05167   Kaposi sarcoma-associated herpesvirus infection mnp05168   Herpes simplex virus 1 infection mnp05169   Epstein-Barr virus infection mnp05170   Human immunodeficiency virus 1 infection mnp05171   Coronavirus disease - COVID-19 mnp05200   Pathways in cancer mnp05320   Autoimmune thyroid disease mnp05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     132009205    04151 PI3K-Akt signaling pathway     132009205   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     132009205  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     132009205  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     132009205    04621 NOD-like receptor signaling pathway     132009205    04622 RIG-I-like receptor signaling pathway     132009205    04623 Cytosolic DNA-sensing pathway     132009205    04650 Natural killer cell mediated cytotoxicity     132009205  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     132009205   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     132009205    05161 Hepatitis B     132009205    05160 Hepatitis C     132009205    05171 Coronavirus disease - COVID-19     132009205    05164 Influenza A     132009205    05162 Measles     132009205    05168 Herpes simplex virus 1 infection     132009205    05163 Human cytomegalovirus infection     132009205    05167 Kaposi sarcoma-associated herpesvirus infection     132009205    05169 Epstein-Barr virus infection     132009205    05165 Human papillomavirus infection     132009205   09171 Infectious disease: bacterial    05152 Tuberculosis     132009205   09163 Immune disease    05320 Autoimmune thyroid disease     132009205   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     132009205   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     132009205  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mnp04052]     132009205 Cytokines and neuropeptides [BR:mnp04052]  Cytokines   Interferons    132009205 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon ubiquitin Motif Other DBs NCBI-GeneID:  132009205 NCBI-ProteinID:  XP_059243511 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search MALPCSFVVALVVLSCQSLGSLGCDLLQYHSVLHWRTLKLLQQMRRLSASSCDKYTNDFG FPQEVFDGKVLQKAHALSVIHVTNQKTFHLFCTEASPAPWNTTILEELCSGHSGQLGHLE ACPLQEAGVGELPLVNGDTILRSYFQRISLYLQEKQSSPCAWEMVRAEIMKPLYASTALH KRLRSGK NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggccctgccctgctccttcgtggtggccctggtggtgcttagctgccaatccctcggc tctctgggatgtgacctgcttcagtatcacagcgtgttgcactggaggaccctgaagctc ctgcaacaaatgaggagactgtctgctagctcttgtgacaaatacacaaatgactttggc ttcccccaggaggtgtttgacggcaaggtgctgcagaaggctcatgccctctctgtcatc catgtgacgaaccagaagaccttccacctcttctgcacagaggcctcacctgctccctgg aacacgaccatcctggaggaattgtgctcgggacattctgggcagctgggccacctggaa gcctgtcccctgcaggaggcaggggtgggagagctgcccctggtgaatggggacaccatc ctgaggagctactttcagagaatctccctctatctgcaagagaagcaatccagcccttgt gcctgggagatggtccgagcagagatcatgaaacccttgtatgcatcaacagccttgcat aagagactaaggagtggcaagtga

DBGET integrated database retrieval system